[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54412.1
DDBJ      :             dimethylsulfoxide reductase, chain B
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  498/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:206 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->158 1kqfB PDBj 3e-25 32.0 %
:RPS:PDB   60->137 1bc6A PDBj 2e-12 25.0 %
:RPS:SCOP  3->158 1kqfB1  d.58.1.5 * 6e-36 30.8 %
:HMM:SCOP  1->188 1q16B_ d.58.1.5 * 4.8e-63 41.7 %
:HMM:PFM   8->24 PF00037 * Fer4 2.9e-06 41.2 17/24  
:HMM:PFM   73->84 PF00037 * Fer4 0.00058 58.3 12/24  
:HMM:PFM   95->114 PF00037 * Fer4 7.9e-11 60.0 20/24  
:BLT:SWISS 2->205 DMSB_ECOLI 3e-73 57.6 %
:PROS 99->110|PS00198|4FE4S_FER_1
:REPEAT 2|9->23|95->109

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54412.1 GT:GENE ACV54412.1 GT:PRODUCT dimethylsulfoxide reductase, chain B GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 543538..544158 GB:FROM 543538 GB:TO 544158 GB:DIRECTION + GB:PRODUCT dimethylsulfoxide reductase, chain B GB:NOTE TIGRFAM: dimethylsulfoxide reductase, chain B; PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: ecm:EcSMS35_2225 dimethylsulfoxide reductase, B subunit GB:PROTEIN_ID ACV54412.1 GB:DB_XREF GI:257474092 InterPro:IPR001450 InterPro:IPR014297 InterPro:IPR017900 LENGTH 206 SQ:AASEQ MTQYGFHFDGKRCTGCKTCVLACKDNKDLSAEISFRKVYEYGGGTWSQSDGLWSNDAFGYYVSVACNHCDSPACMAKCPQGAISKDPDTGIVNNDPEKCIGCGTCAIACPYSAPKVDEEIKKAVRCDMCADRVAEGKQPICVEACPLRALDFGEISELRQKYGEMADIAPLPSADETKPNIVITEPVNAKPAGDATGSVLNEREIA GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 2->205|DMSB_ECOLI|3e-73|57.6|203/205| PROS 99->110|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|9->23|95->109| BL:PDB:NREP 1 BL:PDB:REP 9->158|1kqfB|3e-25|32.0|150/289| RP:PDB:NREP 1 RP:PDB:REP 60->137|1bc6A|2e-12|25.0|76/77| HM:PFM:NREP 3 HM:PFM:REP 8->24|PF00037|2.9e-06|41.2|17/24|Fer4| HM:PFM:REP 73->84|PF00037|0.00058|58.3|12/24|Fer4| HM:PFM:REP 95->114|PF00037|7.9e-11|60.0|20/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 3->158|1kqfB1|6e-36|30.8|156/244|d.58.1.5| HM:SCP:REP 1->188|1q16B_|4.8e-63|41.7|180/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2396 OP:NHOMOORG 556 OP:PATTERN 22121222344333325-5573363113-1131-433233333-1--13-21222115262---4--- -7911-11111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------5cS334222--------------------1----------------2243333332333311333-4----------------------------------------1-1----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------144-11111111-1-1411-111--1--9--23pl3355-5AB11131---821--1------21--323-22--11111111112-1131121311----------1-1121-11212-1--312111111113----8-4-------------------------------111-122-3211212233333323444413222324211232241443325213124---23----------B3418F638CC8BBAAF188697692-A9A9243827422112211-2-------2B3321163-111-----46997-5H9A9787BA8K8---1832------C5C899-FGGFFFEEFF-FFEGFFFFEFGFFDFFFF89998621BGEFFGGGGGGFEGEFF6AA9DCDE--455555555555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123--------------------------------------------11--11111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 194 STR:RPRED 94.2 SQ:SECSTR ccEEEEEEETTGccccccccTTccHHHTccTTccccTTTccccccccccHHHHHHHHHHEEcccTTTTccccccTTTcTTccEEEccccccEEEcTTTccccccHHHHcGGGccEETTTccHHHHHHHHHHHHHTTccccccccccccTTHHTHHTTcccGGGGccEEcccccccEcTTccEEEcGGGHHEEcT############ PSIPRED ccEEEEEEEHHHcccccHHHHHHHHHHcccccccccccEEcccccccccccccccccEEEEEEEccccccccHHHHHccccccEEEccccEEEEcHHHcccccccHHHcccccEEEEccccEEEEccccHHHHHHccccEEHHHcccccEEEEEHHHHHHHHHHHHHcccccHHHcccccEEEEcccccccccccccccccHHHcc //