[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54421.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:289 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  190->274 1cw0A_ c.52.1.15 * 4.3e-05 20.0 %
:RPS:PFM   188->240 PF04480 * DUF559 2e-05 38.5 %
:HMM:PFM   188->240 PF04480 * DUF559 3.8e-07 36.0 50/109  
:BLT:SWISS 117->254 Y2248_MYCTU 3e-05 27.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54421.1 GT:GENE ACV54421.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 554140..555009 GB:FROM 554140 GB:TO 555009 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54421.1 GB:DB_XREF GI:257474101 LENGTH 289 SQ:AASEQ MAAKEKPRIGEGNRRPAGCALPLHVLIADACVRTETEGVVTHTWGSPFPDTAFAEAGEGFLMSTPEFCFLQMAGCLSLVQLIQLGFELCGTYALVGGAPAVRRAAPLTTKVKLAAFVEQSSGARGCKKAARAVRYVQDGAASPMETMLAMMLCLPYGLGGYGLEKPLINHRVDVPSSSKRLADRAYCVCDLCWPEAKLCVEYDSARYHVDPDRQDSDARRRSTLIALGYTVVTVTRGQVMDAGAFNRLAHQLAKQTGKRLRYSDPDFTRKHRALRSELLQTFALKEDAR GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 117->254|Y2248_MYCTU|3e-05|27.3|121/271| SEG 152->163|lclpyglggygl| RP:PFM:NREP 1 RP:PFM:REP 188->240|PF04480|2e-05|38.5|52/92|DUF559| HM:PFM:NREP 1 HM:PFM:REP 188->240|PF04480|3.8e-07|36.0|50/109|DUF559| HM:SCP:REP 190->274|1cw0A_|4.3e-05|20.0|85/155|c.52.1.15|1/1|Restriction endonuclease-like| OP:NHOMO 23 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------1----------------------------------------------111-11--D4----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 8-20,288-290| PSIPRED ccccccccccccccccccccccEEEEEEcccEEEEcccccEEEccccccHHHHHHHcccEEEccHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccEEEEcccccccccccccEEEEEEccccHHEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccc //