[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54437.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  516/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:215 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->214 2vpyB PDBj 8e-36 44.6 %
:RPS:PDB   59->114 1bc6A PDBj 3e-09 36.4 %
:RPS:PDB   89->189 1bluA PDBj 2e-04 24.6 %
:RPS:SCOP  8->215 1ti2B2  d.58.1.5 * 8e-48 34.5 %
:HMM:SCOP  8->214 1q16B_ d.58.1.5 * 2.1e-71 51.1 %
:HMM:PFM   12->28 PF00037 * Fer4 7.2e-06 52.9 17/24  
:HMM:PFM   88->110 PF00037 * Fer4 2.8e-11 56.5 23/24  
:BLT:SWISS 9->212 PSRB_WOLSU 2e-37 45.7 %
:PROS 95->106|PS00198|4FE4S_FER_1
:REPEAT 2|11->84|88->181

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54437.1 GT:GENE ACV54437.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 573786..574433 GB:FROM 573786 GB:TO 574433 GB:DIRECTION + GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: hha:Hhal_0354 4Fe-4S ferredoxin, iron-sulfur binding domain protein GB:PROTEIN_ID ACV54437.1 GB:DB_XREF GI:257474117 InterPro:IPR000813 InterPro:IPR001450 InterPro:IPR017900 LENGTH 215 SQ:AASEQ MEESHVPHWGMVIDLAKCVGCDSCTVACKAENRTPPGVTYNVVLEQETGAYPNVRIEAIPRPCMQCENPACVSVCPVSATYRGDDGIVVIDADRCIGCKYCIAACPYGARSADEGSSYAVEMQAADQVTAPEYGVDHGARGKYRGTYGTVRKCTFCAHRIAEGEAPACCETCIGDARYFGDLNDPSSKVAQLAASPRAFRLREELGTNPSVYYLK GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 9->212|PSRB_WOLSU|2e-37|45.7|173/191| PROS 95->106|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|11->84|88->181| BL:PDB:NREP 1 BL:PDB:REP 6->214|2vpyB|8e-36|44.6|177/193| RP:PDB:NREP 2 RP:PDB:REP 59->114|1bc6A|3e-09|36.4|55/77| RP:PDB:REP 89->189|1bluA|2e-04|24.6|69/80| HM:PFM:NREP 2 HM:PFM:REP 12->28|PF00037|7.2e-06|52.9|17/24|Fer4| HM:PFM:REP 88->110|PF00037|2.8e-11|56.5|23/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 8->215|1ti2B2|8e-48|34.5|174/195|d.58.1.5| HM:SCP:REP 8->214|1q16B_|2.1e-71|51.1|176/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2419 OP:NHOMOORG 568 OP:PATTERN 22121321344333324-5574473113-112--233333233-1--13-----2-15152---3--- -7911111111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------6dR334222---------1111-11111111---------------2243333332344422333-2----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------133-11111111-1-1411-111--1--9--13nj2354-589--121--1631--1------21--423-32--11111111112-2232232511----------1-1121-11212-1--31211111111311--8-3-------------------------------111-122-3211212233333323444413222334211232241443324213124-1-23----------B3418A556A878877B189787693-BAAA343327422112211-2-------2B3321174-111-----45886-5G9A9687BA7J8---1842------B5C9AA-GGGFGGEFHG-FGFHGFFGGGGGGFGGFFB8AA9621CHDGGHHHHHHGFHFGF79CBEDEF--555555545555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-111111-------------------------------------21-------131 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 99.1 SQ:SECSTR #HHHHcccEEEEEccGGGGccccccTTcccTTcccccccccccccccccHHHHHHHHHcccTTTTccccccTTTcTTccEEEEccccEEEcTTTccccccHHHHcGGGccEETTcTTEEGGGTHHHHHHHccccccccccEEEEcTTcEEEcGGGccTTTTTccccHHHHHcTTccEEEcTTccccHHHHHHHHcccEEcccTTccccccEEEE# DISOP:02AL 215-216| PSIPRED cccccccEEEEEEEccccccccHHHHHHHHHHccccccEEEEEEEEccccccccEEEEEEEccccccccHHHHHcccccEEEcccccEEccccccccccccHHccccccEEEccccccHHHHHHccccccccccccccccccccccccccccccccHHHHHcccccEEHHHcccccEEEEEHHHHHHHHHHHHHccccEEEcHHHcccccEEEEc //