[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54452.1
DDBJ      :             DMSO reductase anchor subunit (DmsC)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  84/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:292 amino acids
:PSIPRED
:RPS:PFM   11->246 PF04976 * DmsC 3e-15 33.5 %
:HMM:PFM   10->282 PF04976 * DmsC 2.8e-39 33.1 269/276  
:BLT:SWISS 11->292 DMSC_ECOLI 3e-15 28.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54452.1 GT:GENE ACV54452.1 GT:PRODUCT DMSO reductase anchor subunit (DmsC) GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 595457..596335 GB:FROM 595457 GB:TO 596335 GB:DIRECTION + GB:PRODUCT DMSO reductase anchor subunit (DmsC) GB:NOTE PFAM: DMSO reductase anchor subunit (DmsC); KEGG: ypm:YP_0363 anaerobic dimethyl sulfoxide reductase chain C GB:PROTEIN_ID ACV54452.1 GB:DB_XREF GI:257474132 InterPro:IPR007059 LENGTH 292 SQ:AASEQ MISGFDTALGEITLVLFTTLAPSGVVAFICMGLPVLGRGASVALRQRLNVFLGLPLVVAMVGLVASATHLGNPANALYVFLGVGRSPLSTEVFCAVVFLALAGLYWLYNFVEHPKPQLQRAWLVLAMLAGAVFVAAVGCAYAADTIVSWHTVYVPLNLMLNALVGGPILAIAGLRAAGYEPVEGRMGRVLTMVAAAALAVNVVTFGVQGADLASIENSYLTAAELVPSYGLMVCAFGVLGMAGIGLDAVELWPRRVRLSVGRAAGAAVLVLAGIFVMRFAFYMMHMTVGLGV GT:EXON 1|1-292:0| BL:SWS:NREP 1 BL:SWS:REP 11->292|DMSC_ECOLI|3e-15|28.8|274/287| TM:NTM 8 TM:REGION 11->33| TM:REGION 48->70| TM:REGION 82->104| TM:REGION 121->143| TM:REGION 153->175| TM:REGION 185->207| TM:REGION 225->247| TM:REGION 264->286| SEG 123->143|lvlamlagavfvaavgcayaa| SEG 189->204|vltmvaaaalavnvvt| SEG 254->273|rrvrlsvgraagaavlvlag| RP:PFM:NREP 1 RP:PFM:REP 11->246|PF04976|3e-15|33.5|233/272|DmsC| HM:PFM:NREP 1 HM:PFM:REP 10->282|PF04976|2.8e-39|33.1|269/276|DmsC| GO:PFM:NREP 2 GO:PFM GO:0016021|"GO:integral to membrane"|PF04976|IPR007059| GO:PFM GO:0019645|"GO:anaerobic electron transport chain"|PF04976|IPR007059| OP:NHOMO 125 OP:NHOMOORG 84 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------242---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1-1--211121-112-122121122211122222-212-----222122222222221212212221---11111111111------------------111----1111---1----------------------------------------111-----11---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //