[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54469.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:170 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->21 PF08085 * Entericidin 0.00076 38.1 21/42  
:BLT:SWISS 48->127 ALF2_SYNY3 6e-04 30.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54469.1 GT:GENE ACV54469.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(616956..617468) GB:FROM 616956 GB:TO 617468 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54469.1 GB:DB_XREF GI:257474149 LENGTH 170 SQ:AASEQ MTRKRGMATAFAAACLVLAGCAGPLNLMQESIYCDDARIAQGFDTYTVANRTGSLFDRKIGGLTGLETWLRISVPNEGGEFRVDYDATVSDGDFKIVFVDEKNVDTVCEGTARGSRVFTLDRGGYALKAVGAHASAEIAFELQASEGVTAVATGDAFDDDQAVDLEPIES GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 48->127|ALF2_SYNY3|6e-04|30.0|80/100| TM:NTM 1 TM:REGION 6->28| SEG 8->23|atafaaaclvlagcag| HM:PFM:NREP 1 HM:PFM:REP 1->21|PF08085|0.00076|38.1|21/42|Entericidin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,45-46,48-48,53-54,59-60,62-62,67-67,81-81,115-115,118-118,123-123,137-137,143-144,146-146,151-152,157-157,160-160,170-171| PSIPRED ccccHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHcccccEEEEEcccccHHHHHccccccccEEEEEEEcccccEEEEEEEEEEccccEEEEEEEccccccEEcccccccEEEEEEcccEEEEEEccccccEEEEEEEcccccEEEEEccccccccEEccccccc //