[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54487.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  522/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:221 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->160 1kqfB PDBj 3e-24 39.2 %
:RPS:PDB   58->133 1bc6A PDBj 2e-12 25.3 %
:RPS:SCOP  1->151 1ti2B2  d.58.1.5 * 2e-42 31.3 %
:HMM:SCOP  1->153 1q16B_ d.58.1.5 * 3.8e-55 49.0 %
:HMM:PFM   7->23 PF00037 * Fer4 4.5e-06 47.1 17/24  
:HMM:PFM   72->80 PF00037 * Fer4 0.00017 77.8 9/24  
:HMM:PFM   89->110 PF00037 * Fer4 1.7e-09 50.0 22/24  
:BLT:SWISS 3->154 PHSB_SALTY 4e-36 45.9 %
:PROS 96->107|PS00198|4FE4S_FER_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54487.1 GT:GENE ACV54487.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 645926..646591 GB:FROM 645926 GB:TO 646591 GB:DIRECTION + GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: ppr:PBPRB0006 putative tetrathionate reductase, subunit B GB:PROTEIN_ID ACV54487.1 GB:DB_XREF GI:257474167 InterPro:IPR001450 InterPro:IPR017900 LENGTH 221 SQ:AASEQ MTQYAIVTDLNRCVGCLACMVACKAVNNVPVGNYWNKVLRIGPSLKEGATSSHDVEMYYLPVQCQHCADPECVKVCPTGASHKLEDGTVQIDKAKCIGCQFCAMSCPYNVRYLNEEEGVVEKCTLCAQIVGQGGLPQCVIQCGGRARFFGDLDQGIESFEAPAVGYDTDRTYDGLYAGNRVTLGELAQDFDASTDLHHLPNVGNDPNFAFILRNRDWKGDE GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 3->154|PHSB_SALTY|4e-36|45.9|148/192| PROS 96->107|PS00198|4FE4S_FER_1|PDOC00176| BL:PDB:NREP 1 BL:PDB:REP 3->160|1kqfB|3e-24|39.2|153/289| RP:PDB:NREP 1 RP:PDB:REP 58->133|1bc6A|2e-12|25.3|75/77| HM:PFM:NREP 3 HM:PFM:REP 7->23|PF00037|4.5e-06|47.1|17/24|Fer4| HM:PFM:REP 72->80|PF00037|0.00017|77.8|9/24|Fer4| HM:PFM:REP 89->110|PF00037|1.7e-09|50.0|22/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 1->151|1ti2B2|2e-42|31.3|150/195|d.58.1.5| HM:SCP:REP 1->153|1q16B_|3.8e-55|49.0|153/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2436 OP:NHOMOORG 580 OP:PATTERN 22121322344333325-5574473113-1131-333333233-1--13-21212115251---4--- -7911-11111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------7dS334222---------1111-11111111---------------2243333332344411333-4----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------134-21111111-1-1411-111--1--9--12pl3354-5AB11131--1731--1------21--423-32--11111111112-2242232511----------1-1121-11212-1--31211111111311--8-2-------------------------------111-122-3311212233333324444413222334211232241443325213124-1-23----------B3418D658BC7BAAAF199797693-A9B9353727422112211-2-------2B3321174-111-----45886-5G9A9787BA8J8---1842------A4D9A9-GGGFGFEEFF-FGFGGFFFFFGFFEGGFF98999621CFDEEFFFFFFEDFDEF68AAEDEF--555555545555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-111111-------------------------------------11--11111131 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 85.1 SQ:SECSTR cccEEEEEccGGGGccccccTTcccTTcccccccccccccccccHHHHHHHHHHHHHEEcccTTTTccccccTTTcTTccEEETccccEEEcTTTccccccHHHHcGGGccEETTTccHHHHHHHHHHHHHTTTcccccccccccTTHHHcccTTHHHHHHHHGcccccEEEEcTHHcEEEEEEEEET################################# PSIPRED ccEEEEEEEccccccccHHHHHHHHHcccccccEEEEEEEcccccccccccccccEEEEEEEccccccccHHHHHccccccEEcccccEEEcHHHcccccHHHHHcccccEEEEccccEEEEccccHHHHHcccccEEHHHcccccEEEEEHHHHHHHHHHHHHcccHHHccccccccccccEEEEEccccccccEEEcccccccccEEEEEEcccccccc //