[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54501.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  519/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:227 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->153 2vpyB PDBj 6e-26 39.7 %
:RPS:PDB   58->134 1bc6A PDBj 3e-12 26.3 %
:RPS:SCOP  1->151 1ti2B2  d.58.1.5 * 1e-41 32.0 %
:HMM:SCOP  1->153 1q16B_ d.58.1.5 * 1.4e-59 49.0 %
:HMM:PFM   9->24 PF00037 * Fer4 5.5e-06 50.0 16/24  
:HMM:PFM   72->80 PF00037 * Fer4 0.00016 77.8 9/24  
:HMM:PFM   89->109 PF00037 * Fer4 1.9e-09 52.4 21/24  
:BLT:SWISS 3->154 PHSB_SALTY 4e-39 48.0 %
:PROS 96->107|PS00198|4FE4S_FER_1
:REPEAT 2|6->23|89->106

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54501.1 GT:GENE ACV54501.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 666486..667169 GB:FROM 666486 GB:TO 667169 GB:DIRECTION + GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: glo:Glov_0934 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:PROTEIN_ID ACV54501.1 GB:DB_XREF GI:257474181 InterPro:IPR001450 InterPro:IPR017900 LENGTH 227 SQ:AASEQ MARYAILTDLNKCVGCLACSIACKVVNSVPVGSYWNKVLRIGPNPRTKGGQWPDVYTYFLTVQCQHCENPECVKVCPTGASHKLEDGTVQIDKSKCIGCQFCAMSCPYSVRYLNEEEGVVEKCTLCEQKIAQGELPQCVSECGGRARFFGDLDQGLESFEAPGCDLQDPSYDAQAKARMKWGDLIGDSCDYPVKPYDENEVYHLPDVGNAPSFVYILRNEKWQGGGE GT:EXON 1|1-227:0| BL:SWS:NREP 1 BL:SWS:REP 3->154|PHSB_SALTY|4e-39|48.0|148/192| PROS 96->107|PS00198|4FE4S_FER_1|PDOC00176| NREPEAT 1 REPEAT 2|6->23|89->106| BL:PDB:NREP 1 BL:PDB:REP 1->153|2vpyB|6e-26|39.7|146/193| RP:PDB:NREP 1 RP:PDB:REP 58->134|1bc6A|3e-12|26.3|76/77| HM:PFM:NREP 3 HM:PFM:REP 9->24|PF00037|5.5e-06|50.0|16/24|Fer4| HM:PFM:REP 72->80|PF00037|0.00016|77.8|9/24|Fer4| HM:PFM:REP 89->109|PF00037|1.9e-09|52.4|21/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 1->151|1ti2B2|1e-41|32.0|150/195|d.58.1.5| HM:SCP:REP 1->153|1q16B_|1.4e-59|49.0|147/509|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 2512 OP:NHOMOORG 577 OP:PATTERN 22121322344333325-5574473113-1131-333333232-1--13-21212115251---4--- -7911111111--1-2211-11--1211111-12221-111---11211-----11----2122112-31---------7dS334222---------1111111-11-11---------------2243333332344411333-4----------------------------------------211----1111111-111111111-11-1111--2---1------1-1111111111111111111--------1---11-1-------------------------------------------------------134-11111111-1-1411-111--1--9--13pl3354-5AB11131--1631--1------21--423-32--11111111112-2242232511----------1-1121-11212-1--31211111111311--7-3-------------------------------11--122-3211212233333323444413222334211232241443325213124-1-23----------B3418C658CC7BAAAE198797693-BABA353827412112211-2-------2B3321173-111-----45886-5G9A9687BA7J8---1842------B5D99A-HIIGHGFFHH-HHGIHGGHGHIGHFHHHHA9AA8621CGEGGHHHHHHGFHFGG6ACBFEFG--555555555555---1---------1112-444444133232114-------1-12-22221-1--11114-------------2333111114422322------------123-1111---------------------------------------21--11111131 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------3---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 89.4 SQ:SECSTR ccEEEEEEccGGGGccccccTTcccTTccccccccccccccccccccHHHHHHHHHHEEcccTTTTccccccTTTcTTccEEETccccEEEcTTTccccccHHHHcGGGccEETTTccHHHHHHHHHHHHHTTccccccccccccTTHHHcccTTHHHHHHHHHHHHHTTcTTcEEEccGHHGGTcccEEEEETTTTcGGGTT######################## DISOP:02AL 227-228| PSIPRED ccEEEEEEEccccccccHHHHHHHHHHcccccccEEEEEEEcccccccccEEcccEEEEEccccccccccHHHHHccccccccccccccccccccccccccHHHHcccccEEEEccccEEEEccccccHHHHccccEEHHHcccccEEEEEHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccEEEcccccHHHcccccccccccEEEEccccccccccc //