[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54510.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:324 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   186->237 PF12582 * DUF3757 0.00066 27.5 51/121  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54510.1 GT:GENE ACV54510.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 681077..682051 GB:FROM 681077 GB:TO 682051 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: RP1L1; retinitis pigmentosa 1-like 1 GB:PROTEIN_ID ACV54510.1 GB:DB_XREF GI:257474190 LENGTH 324 SQ:AASEQ MPASIHPPVQLHIVLDEDSYQGGDSVEMARRFTAVAPTDVVRASKGSQRANVLRFDLGDDVVTAEADDDPLWRDALTTWLDEEFAETSALVARENDARQNNGEQPVPFAWAEVKFGAGPVIAIRMKDSAIPPEAAGFVARARQLLVGGAFGADDIAAIRIPACASIEAQRADAHRAEYLEAQQYEAEHRPVLQEVDRYSEEVDLATGEGWTDELQGSQSKRDAPTDSELAEAVAEAEAALRQGVDPSDIAAEDRAADVDAGDFAVDVEAVEAGGASDDVDTSGEGCALEGGGVPEHLDYRVWNVAYADGTSVRFDSVLGEALID GT:EXON 1|1-324:0| SEG 147->158|ggafgaddiaai| SEG 176->187|aeyleaqqyeae| SEG 228->240|elaeavaeaeaal| SEG 255->275|aadvdagdfavdveaveagga| HM:PFM:NREP 1 HM:PFM:REP 186->237|PF12582|0.00066|27.5|51/121|DUF3757| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 59-59,137-137,143-144,146-146,151-151,171-171,174-174,179-179,207-207,213-213,216-216,241-242,244-244,249-249,269-270,272-272,277-277,283-283,286-286,291-291,297-297,300-300,305-305,324-325| PSIPRED ccccccccEEEEEEEcccccccccHHHHHHHHHccccHHHHHcccccccccEEEEEccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccccEEHHEEEcccccEEEEEEccccccccHHHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccccHHHHHHHHHHHHHHHHccccHHHccHHHHccccccccEEEEEEHEEcccccccccccccccEEccccccccccEEEEEEEEcccccEEHHHHHHHHHcc //