[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54519.1
DDBJ      :             HhH-GPD family protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  252/915 : Eukaryota  81/199 : Viruses  0/175   --->[See Alignment]
a.96.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->203 2h56B PDBj 5e-29 35.9 %
:RPS:PDB   41->206 3cwsC PDBj 8e-26 25.9 %
:RPS:SCOP  40->199 1dizA1  a.96.1.3 * 8e-25 25.7 %
:HMM:SCOP  30->206 1mpgA1 a.96.1.3 * 6.5e-36 36.1 %
:RPS:PFM   51->153 PF00730 * HhH-GPD 2e-08 36.4 %
:HMM:PFM   48->187 PF00730 * HhH-GPD 3e-18 33.0 100/121  
:BLT:SWISS 44->202 MAG1_SCHPO 4e-19 31.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54519.1 GT:GENE ACV54519.1 GT:PRODUCT HhH-GPD family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 692669..693328 GB:FROM 692669 GB:TO 693328 GB:DIRECTION + GB:PRODUCT HhH-GPD family protein GB:NOTE PFAM: HhH-GPD family protein; SMART: HhH-GPD family protein; KEGG: dds:Ddes_1159 HhH-GPD family protein GB:PROTEIN_ID ACV54519.1 GB:DB_XREF GI:257474199 InterPro:IPR003265 LENGTH 219 SQ:AASEQ MEREPRYFEYGEAEVAYLAARDPRLGEAMAVIGRIEREVHPDLFAALVNCIVGQQIATKAQTTIWNRMLERFGEVTPEAMAACSDDELQQVGISFRKVGYIKGAAARVLSGEVDLEGLAELSDDEVCRTLSALPGIGVWTAEMLMTFSMQRPNILSWGDLAIHRGLRMVHHHRRITPELFAKYRRRYTPYGSVASLYLWEVAGGAIPGMKDWAPKSEKR GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 44->202|MAG1_SCHPO|4e-19|31.4|159/228| BL:PDB:NREP 1 BL:PDB:REP 6->203|2h56B|5e-29|35.9|195/213| RP:PDB:NREP 1 RP:PDB:REP 41->206|3cwsC|8e-26|25.9|158/281| RP:PFM:NREP 1 RP:PFM:REP 51->153|PF00730|2e-08|36.4|99/144|HhH-GPD| HM:PFM:NREP 1 HM:PFM:REP 48->187|PF00730|3e-18|33.0|100/121|HhH-GPD| GO:PFM:NREP 1 GO:PFM GO:0006284|"GO:base-excision repair"|PF00730|IPR003265| RP:SCP:NREP 1 RP:SCP:REP 40->199|1dizA1|8e-25|25.7|152/183|a.96.1.3| HM:SCP:REP 30->206|1mpgA1|6.5e-36|36.1|169/183|a.96.1.3|1/1|DNA-glycosylase| OP:NHOMO 402 OP:NHOMOORG 344 OP:PATTERN ------------------------1111-111---------------1---------11-------1- 1111---------------------------------------------------------------------------11-1------------------1---1-1-1--------------1-----------111-----1--11111------------1-1--1-------------111------111121222212222221111122221111-11------21-------------------1-----------------------------------------------------------------------1---111-1-1---------------------111--------------2-1-11-------111111---111----------1---1--1--111-111-1111111111-1111-1111111--------11111--1-----------------------------11121122212211112111112222111111221111211222212111121121211111-1-------11--11--------1---------1---------11--------------------------------------------------------------------------11--1------------------------------11111-11----------------1---------111111111111-----------------------------------------11--1111211--11111-11----------1-----------111-111111111111------1122-------------------------------1---------------1- --11----------1-1111111111111-11-111111111111111111111-1111----11--11--1--1--1-----1--21---111111111111111--2------------------------------------------------------------------11115----1222414-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 94.1 SQ:SECSTR HHHHHHHTTTTHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHTccccHHHHHHHHHHHHHHHcEEcHHHHHTccHHHHHHTTccHHHHHHHHHHHHHHHHTHHcccccccccHHHHHHHHTTcTTccHHHHHHHHHHHccccccccTTcHHHHHHcHHHcccTTccHHHHHHHHGGGTTcHHHHHHHHHTcccccc############# DISOP:02AL 218-220| PSIPRED cccccHHccccHHHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEccHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHccccccccc //