[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54523.1
DDBJ      :             type II secretion system protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  158/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:322 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   150->260 3c1qB PDBj 5e-08 13.5 %
:RPS:PFM   153->277 PF00482 * GSPII_F 6e-06 34.2 %
:HMM:PFM   153->278 PF00482 * GSPII_F 2.8e-16 30.6 121/124  
:HMM:PFM   113->147 PF01484 * Col_cuticle_N 0.00037 8.8 34/53  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54523.1 GT:GENE ACV54523.1 GT:PRODUCT type II secretion system protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 697070..698038 GB:FROM 697070 GB:TO 698038 GB:DIRECTION + GB:PRODUCT type II secretion system protein GB:NOTE PFAM: type II secretion system protein; KEGG: gbm:Gbem_1054 type II secretion system protein GB:PROTEIN_ID ACV54523.1 GB:DB_XREF GI:257474203 InterPro:IPR001992 LENGTH 322 SQ:AASEQ MEAHVVLGGVGVLAAFGCGAAASASVAGRARRRTASLVGEGDVGSSRVAWLLRNGVGWTRPVTRALLGNRALAALMREAVGVVDARGLMTTEESLLSVWIAAMVGAGMCAGAAAGSVVCGIAVAVCACACAVVWLRTVQDKRRDALREGIPDALRSMAVCFQAGLSLLQTFQQVASEVQGPLGTLFARAAHQLETGEGAGRALEVLRRGSSVAELAFVAVALDVQHQAGGSMKQVLDAARDTVQSEIELRRALRVQTAQAKLSARVVSVLPFVLIAVFSLVSEGFLDPFFASPMGMALLAIALGMQAAGIVAVRRMLAVEVG GT:EXON 1|1-322:0| TM:NTM 7 TM:REGION 5->27| TM:REGION 92->114| TM:REGION 116->137| TM:REGION 155->177| TM:REGION 209->231| TM:REGION 263->285| TM:REGION 292->313| SEG 3->35|ahvvlggvgvlaafgcgaaasasvagrarrrta| SEG 64->77|rallgnralaalmr| SEG 100->133|iaamvgagmcagaaagsvvcgiavavcacacavv| RP:PDB:NREP 1 RP:PDB:REP 150->260|3c1qB|5e-08|13.5|104/112| RP:PFM:NREP 1 RP:PFM:REP 153->277|PF00482|6e-06|34.2|120/124|GSPII_F| HM:PFM:NREP 2 HM:PFM:REP 153->278|PF00482|2.8e-16|30.6|121/124|GSPII_F| HM:PFM:REP 113->147|PF01484|0.00037|8.8|34/53|Col_cuticle_N| OP:NHOMO 198 OP:NHOMOORG 158 OP:PATTERN -------------------------------------------------------------------- 1-3-------------------------------------------------132-------1---------------1121-------------------------------------------11----121--11132---11--------------------------------------------1----------------------------------------1------------------------------------------------------------------------------------------------------------------------------111--------------31111------121211111111----------1-11-1111123111111211112-1---2111-1111111--------1----1--------------------------------1221--111-211112--111--222222112111121--111-------1111----11------------11--1---1--1-1-111-2-1----1111111-11--------------------------------------1-----------1----12----------------1------------------------------------11-------------------------------------------------------1-----------------------------------11---------------------112-----21232------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 35.1 SQ:SECSTR ############################################################################################################################################ccccccHHHHHHHHHHHHHHHHTT#cHHHHHHHHHHTcccHHHHHHHHHHHHHHTTccHHHHHT######TcTTTccHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHH############################################################## DISOP:02AL 8-15,17-18| PSIPRED cccEEEEccHHHHHccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccc //