[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54532.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->25 TCAA_STAAT 2e-04 48.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54532.1 GT:GENE ACV54532.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 703327..703746 GB:FROM 703327 GB:TO 703746 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: similar to elastin microfibril interfacer 2 GB:PROTEIN_ID ACV54532.1 GB:DB_XREF GI:257474212 LENGTH 139 SQ:AASEQ MKTCPTCGARAFDDAEVCFGCLHRYGEEPVRPNVAMPTMPSSPGTGHCPTLRPKAAPAEPKPPQEAPPRDGAGWTVRFELPGYAPVMEADGREGGVVVRFQPSDEVGGAGDGGRRVPRGTHARDAPSENRASASAAGRS GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 1->25|TCAA_STAAT|2e-04|48.0|25/460| SEG 53->68|pkaapaepkppqeapp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-26,31-32,34-34,39-39,53-53,59-60,62-62,67-67,115-115,118-118,123-124,129-130,132-132| PSIPRED ccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccEEcccccccEEEEEccccccccccccccccccccccccccccccHHHHccccc //