[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54536.1
DDBJ      :             TadE family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->48 PF07811 * TadE 5e-04 39.5 %
:HMM:PFM   6->40 PF07811 * TadE 7.2e-09 42.9 35/43  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54536.1 GT:GENE ACV54536.1 GT:PRODUCT TadE family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 705402..705875 GB:FROM 705402 GB:TO 705875 GB:DIRECTION + GB:PRODUCT TadE family protein GB:NOTE PFAM: TadE family protein; KEGG: pca:Pcar_1749 Flp pilus assembly protein TadG GB:PROTEIN_ID ACV54536.1 GB:DB_XREF GI:257474216 InterPro:IPR012495 LENGTH 157 SQ:AASEQ MRGERGSEVVQFVIVLPLLLAVVFSIVQLAGMTLAASQLSSEITRACRQLDATGFELAANKERFVEEGILGASTQLDPARLHVEHVSWTSERTKREQPVRDGGAIEEQSTVIEASYDVSYLLPAVADLPGLAGRVLKRHVRCSFVDGRAIEIRQEGL GT:EXON 1|1-157:0| TM:NTM 1 TM:REGION 10->32| RP:PFM:NREP 1 RP:PFM:REP 6->48|PF07811|5e-04|39.5|43/43|TadE| HM:PFM:NREP 1 HM:PFM:REP 6->40|PF07811|7.2e-09|42.9|35/43|TadE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,34-34,39-40,45-46,48-48,53-53,67-67,73-74,76-76,81-82,87-88,90-90,95-95,129-129,132-132,157-158| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHccccccccccHHHEEEEEEEHHHHHHHHHccccccccccccccEEEcccHHHHHHHHHHccccHHHHHHHHHcEEEEEcccEEEHHHccc //