[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54541.1
DDBJ      :             type II secretion system protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:313 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   163->252 3c1qA PDBj 2e-07 22.0 %
:HMM:PFM   172->297 PF00482 * GSPII_F 2.3e-14 26.3 118/124  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54541.1 GT:GENE ACV54541.1 GT:PRODUCT type II secretion system protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 709672..710613 GB:FROM 709672 GB:TO 710613 GB:DIRECTION + GB:PRODUCT type II secretion system protein GB:NOTE PFAM: type II secretion system protein; KEGG: type II secretion system protein GB:PROTEIN_ID ACV54541.1 GB:DB_XREF GI:257474221 InterPro:IPR001992 LENGTH 313 SQ:AASEQ MIAGGAGAAVCAMLVLGAIGGLAAYEAFVRYAAPARRDVVAPSSASASKDGHRAGGASRRRRATEAFGAFAAFLDKRVPLTRADVESSRDRLSRAGVELEPETWRSIRVVSALGCAGLAGVAAAGMGFEPPAFAGAAACCAACGWMAPSWALSRRERNRRRAIELALPDAMELLGIAIAAGSPIEQCFREVAESMDGPLAREFSLVDREVNLLGRSREEALEHLGQRCRSQDVSAFTAQLMQAVSQGSSLTEGLAVQAALARETAQAEAMERIRKMPTKLDIVLSLCFLPPTVALVVVPTVVNLLNFLNDSMG GT:EXON 1|1-313:0| TM:NTM 3 TM:REGION 4->26| TM:REGION 105->127| TM:REGION 131->153| SEG 51->63|ghraggasrrrra| SEG 112->148|algcaglagvaaagmgfeppafagaaaccaacgwmap| SEG 154->161|rrernrrr| SEG 254->269|lavqaalaretaqaea| SEG 288->309|flpptvalvvvptvvnllnfln| RP:PDB:NREP 1 RP:PDB:REP 163->252|3c1qA|2e-07|22.0|82/111| HM:PFM:NREP 1 HM:PFM:REP 172->297|PF00482|2.3e-14|26.3|118/124|GSPII_F| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------1--------------------------2-------------------------------------------------------111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------1-----11----------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 26.2 SQ:SECSTR ##################################################################################################################################################################cHHHHHHHHHHHHHHHHTT#cHHHHHHHHHHTcccHHHHHHHHHHHHHH#TTccHHHHHTTcTTT######ccHHHHHHHHHHHHTcHHH############################################################# DISOP:02AL 9-14,17-18,313-314| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccc //