[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54545.1
DDBJ      :             protein of unknown function UPF0150
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.304.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->63 2dsyA PDBj 2e-06 11.1 %
:HMM:SCOP  2->72 1wv8A1 d.304.1.1 * 0.00012 22.5 %
:HMM:PFM   4->49 PF03681 * UPF0150 1.7e-13 41.3 46/48  
:BLT:SWISS 76->127 Y2337_MYCBO 2e-04 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54545.1 GT:GENE ACV54545.1 GT:PRODUCT protein of unknown function UPF0150 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 713342..713806 GB:FROM 713342 GB:TO 713806 GB:DIRECTION + GB:PRODUCT protein of unknown function UPF0150 GB:NOTE PFAM: protein of unknown function UPF0150; KEGG: bph:Bphy_1857 hypothetical protein GB:PROTEIN_ID ACV54545.1 GB:DB_XREF GI:257474225 InterPro:IPR005357 LENGTH 154 SQ:AASEQ MRYMYPAIFTENELDGYSVQFVDFENGYTCGDDMEDAVAMAAEVLWLLIDDYLQLDKPLPKPTYPIEHEGLLVALSVDVDTERGVLTTKMAAHLLGVSDARVRQMICSGQLAAKKQGRDNYVYLSSVKERLNNPPKPGRPRKSDRLESVAETAS GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 76->127|Y2337_MYCBO|2e-04|40.4|52/114| SEG 32->44|ddmedavamaaev| RP:PDB:NREP 1 RP:PDB:REP 1->63|2dsyA|2e-06|11.1|63/78| HM:PFM:NREP 1 HM:PFM:REP 4->49|PF03681|1.7e-13|41.3|46/48|UPF0150| HM:SCP:REP 2->72|1wv8A1|0.00012|22.5|71/0|d.304.1.1|1/1|TTHA1013-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 68 STR:RPRED 44.2 SQ:SECSTR HHHHHTcEEEccccccEEEEcTTcTTcEEEEccHHHHHHHHHHHHHHHHHHHHHTTccccccT#Tcccc##################################################################################### DISOP:02AL 125-125,129-133,137-138| PSIPRED cccEEEEEEEEcccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHcccccEEEEHHHHHHHcccccccccccHHHHHHHHHHcc //