[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54554.1
DDBJ      :             FeoA family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.1
:73 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->67 3e19A PDBj 2e-10 27.3 %
:RPS:SCOP  1->67 1bi0A3  b.34.1.2 * 1e-07 17.2 %
:RPS:PFM   1->67 PF04023 * FeoA 8e-08 43.3 %
:HMM:PFM   1->68 PF04023 * FeoA 6.7e-20 42.6 68/74  
:BLT:SWISS 1->67 FEOB1_PORGI 7e-05 35.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54554.1 GT:GENE ACV54554.1 GT:PRODUCT FeoA family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 723742..723963 GB:FROM 723742 GB:TO 723963 GB:DIRECTION + GB:PRODUCT FeoA family protein GB:NOTE PFAM: FeoA family protein; KEGG: sat:SYN_02208 Fe2+ transport system protein B GB:PROTEIN_ID ACV54554.1 GB:DB_XREF GI:257474234 InterPro:IPR007167 LENGTH 73 SQ:AASEQ MPLSFLKGGETGTIAKVRGRGDLHHHLENLGFVEGAQVTVVSEAAGDLIVEVKGIQVALNRQVAAHIITNAAA GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|FEOB1_PORGI|7e-05|35.8|67/100| RP:PDB:NREP 1 RP:PDB:REP 1->67|3e19A|2e-10|27.3|66/74| RP:PFM:NREP 1 RP:PFM:REP 1->67|PF04023|8e-08|43.3|67/74|FeoA| HM:PFM:NREP 1 HM:PFM:REP 1->68|PF04023|6.7e-20|42.6|68/74|FeoA| GO:PFM:NREP 1 GO:PFM GO:0005506|"GO:iron ion binding"|PF04023|IPR007167| RP:SCP:NREP 1 RP:SCP:REP 1->67|1bi0A3|1e-07|17.2|64/77|b.34.1.2| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111--1--11----1-----11---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 91.8 SQ:SECSTR EEGGGccTTcEEEEEEEccHHHHHHHHHTTTccTTcEEEEEEEccccEEEEETTEEEEEcHHHHTTE###### DISOP:02AL 73-74| PSIPRED ccccEEccccccEEEEEEcccHHHHHHHHcccccccEEEEEEccccEEEEEEEEEEEEEEcHHEEEEHHcccc //