[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54557.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->74 PF01096 * TFIIS_C 0.00063 36.4 22/39  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54557.1 GT:GENE ACV54557.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 727080..727310 GB:FROM 727080 GB:TO 727310 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: hypothetical protein LOC100021312 GB:PROTEIN_ID ACV54557.1 GB:DB_XREF GI:257474237 LENGTH 76 SQ:AASEQ MFGLEFTPSTVVVALIVLALVFLAVRRLVRNGMCDCHKGDDAHGGCAGGCGGCSGCGAASAMVADMQKRAAAESHR GT:EXON 1|1-76:0| TM:NTM 2 TM:REGION 4->25| TM:REGION 43->65| SEG 11->30|vvvalivlalvflavrrlvr| SEG 44->61|ggcaggcggcsgcgaasa| HM:PFM:NREP 1 HM:PFM:REP 53->74|PF01096|0.00063|36.4|22/39|TFIIS_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-26,31-32,34-34,39-40,45-45,48-48,53-53| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcc //