[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54558.1
DDBJ      :             iron (metal) dependent repressor, DtxR family
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  151/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.76.1
:126 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->122 1u8rH PDBj 1e-10 30.3 %
:RPS:PDB   4->126 1bi2B PDBj 7e-07 22.3 %
:RPS:SCOP  9->77 2p8tA1  a.4.5.72 * 1e-06 22.6 %
:RPS:SCOP  66->122 1b1bA2  a.76.1.1 * 2e-13 29.8 %
:HMM:SCOP  4->65 1g3sA1 a.4.5.24 * 2.5e-10 41.0 %
:HMM:SCOP  66->126 1g3sA2 a.76.1.1 * 2.4e-13 37.7 %
:RPS:PFM   4->61 PF01325 * Fe_dep_repress 3e-05 47.4 %
:RPS:PFM   66->121 PF02742 * Fe_dep_repr_C 1e-06 33.9 %
:HMM:PFM   66->122 PF02742 * Fe_dep_repr_C 2.2e-16 29.8 57/71  
:HMM:PFM   4->56 PF01325 * Fe_dep_repress 8.2e-12 30.8 52/60  
:BLT:SWISS 4->123 Y568_METJA 8e-17 33.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54558.1 GT:GENE ACV54558.1 GT:PRODUCT iron (metal) dependent repressor, DtxR family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 727760..728140 GB:FROM 727760 GB:TO 728140 GB:DIRECTION + GB:PRODUCT iron (metal) dependent repressor, DtxR family GB:NOTE PFAM: iron dependent repressor; SMART: iron dependent repressor; KEGG: dps:DP2966 iron-dependent repressor GB:PROTEIN_ID ACV54558.1 GB:DB_XREF GI:257474238 InterPro:IPR001367 LENGTH 126 SQ:AASEQ MEKMSMSHEDYLEAIVMLGGTTEVSVRSVDIATKLDVSKASVNKAISSLKEKGLADQPYYGDITLTEEGYAYGMSVLDRHHMLFTFLTKALGIPEEQAEKEACLMEHAISDESFKKWSSYINKLDL GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 4->123|Y568_METJA|8e-17|33.3|120/125| BL:PDB:NREP 1 BL:PDB:REP 1->122|1u8rH|1e-10|30.3|119/222| RP:PDB:NREP 1 RP:PDB:REP 4->126|1bi2B|7e-07|22.3|121/138| RP:PFM:NREP 2 RP:PFM:REP 4->61|PF01325|3e-05|47.4|57/59|Fe_dep_repress| RP:PFM:REP 66->121|PF02742|1e-06|33.9|56/68|Fe_dep_repr_C| HM:PFM:NREP 2 HM:PFM:REP 66->122|PF02742|2.2e-16|29.8|57/71|Fe_dep_repr_C| HM:PFM:REP 4->56|PF01325|8.2e-12|30.8|52/60|Fe_dep_repress| GO:PFM:NREP 6 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01325|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF01325|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01325|IPR001367| GO:PFM GO:0003700|"GO:transcription factor activity"|PF02742|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF02742|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02742|IPR001367| RP:SCP:NREP 2 RP:SCP:REP 9->77|2p8tA1|1e-06|22.6|62/67|a.4.5.72| RP:SCP:REP 66->122|1b1bA2|2e-13|29.8|57/76|a.76.1.1| HM:SCP:REP 4->65|1g3sA1|2.5e-10|41.0|61/0|a.4.5.24|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 66->126|1g3sA2|2.4e-13|37.7|61/0|a.76.1.1|1/1|Iron-dependent repressor protein, dimerization domain| OP:NHOMO 218 OP:NHOMOORG 188 OP:PATTERN --111------------------2-111---21111111111112222-121111111111---1--- 1-1--11-1121-211-11-11--111111111111-111-----11-11111122-1-------11---1-------12311---------------------1----1------------------------1-11111--1---------------------------------------1---1--1-------------------------------------------111111111111111111-1---11-1---111111-1----1-------1---------------------------------------1-132221111-2---221---1-11--11-133-1-11----------111--------------------1-------------11111111---------------------2-----------------1---1--------------------------------------------------------------------------------------------------------------11-111------------------------2----------------------------------------------------------------------------1------------------------------------------------------1-------1-----------------------------1------------------------------------------------------1--------------11---------------1--------------1-----------------------------1---1---1-2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcTTccEEEcHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHccHHHHHHHHHHcccccc PSIPRED cccccHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEcccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHccccc //