[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54567.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->145 PF04695 * Pex14_N 1.5e-05 12.3 73/136  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54567.1 GT:GENE ACV54567.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 737458..737943 GB:FROM 737458 GB:TO 737943 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: GE14975 gene product from transcript GE14975- RA GB:PROTEIN_ID ACV54567.1 GB:DB_XREF GI:257474247 LENGTH 161 SQ:AASEQ MADDTKNTDSGTPQQPDAAPQPPATPPTEPLPQQQPSMGQQVPPAQPQPQQPMYGAPQPQPQAFYPPAPLMQLTGGMKFAWLVVGALLGIPGIIIAWLVNVDKMPQVKSDALKFAIIGFVIWIVLQFIFGMIVFGTISAAMYGLMNSVDMGSYNYGYHGSW GT:EXON 1|1-161:0| TM:NTM 2 TM:REGION 80->102| TM:REGION 115->137| SEG 12->36|tpqqpdaapqppatppteplpqqqp| SEG 40->69|qqvppaqpqpqqpmygapqpqpqafyppap| SEG 82->96|lvvgallgipgiiia| HM:PFM:NREP 1 HM:PFM:REP 15->145|PF04695|1.5e-05|12.3|73/136|Pex14_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 115-115,118-118,123-123,129-129,137-137,161-162| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //