[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54576.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   52->88 PF09678 * Caa3_CtaG 0.00054 18.9 37/244  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54576.1 GT:GENE ACV54576.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 748543..749358 GB:FROM 748543 GB:TO 749358 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54576.1 GB:DB_XREF GI:257474256 LENGTH 271 SQ:AASEQ MTDLDTRVRQAFDNVTVPDDVKRGTLTYIASIAEASGVSAETAPASAAAPRKHARARIIPLRRAAAALAACLALAFAGFGGFAYAQPTTYVGIDVNPSIELGVNRFGIVVRVEALNGDGESLLDAVSLTGRGYADALSLLTQSDAFSPYAQEDSYIEISVTSDDARQAEAIRQQSDACLSALPCRGSCHAVDEGTREAAVSAGMGVGRYRAALELVELDPSVTLEECASLSMRELRDRIAALSSGDSEGRGSGNGQHGHGGGGGQHGKGNR GT:EXON 1|1-271:0| TM:NTM 1 TM:REGION 64->86| SEG 40->85|aetapasaaaprkharariiplrraaaalaaclalafagfggfaya| SEG 249->270|grgsgngqhghgggggqhgkgn| HM:PFM:NREP 1 HM:PFM:REP 52->88|PF09678|0.00054|18.9|37/244|Caa3_CtaG| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,39-39,41-62| PSIPRED cccHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccEEEEEEcccccEEEEEEccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccEEEEEEEcccccHHHHHHHHHHHHHccccEEEccEEEcHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccc //