[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54580.1
DDBJ      :             histidyl-tRNA synthetase
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  872/915 : Eukaryota  85/199 : Viruses  0/175   --->[See Alignment]
c.51.1d.104.1
:457 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->420 1adjA PDBj 8e-75 41.1 %
:RPS:PDB   3->420 1adjA PDBj 1e-47 40.2 %
:RPS:SCOP  11->326 1usyA  d.104.1.1 * 1e-49 17.0 %
:RPS:SCOP  342->420 1wu7A1  c.51.1.1 * 3e-15 21.5 %
:HMM:SCOP  2->336 1kmmA2 d.104.1.1 * 2.7e-78 34.0 %
:HMM:SCOP  341->435 1adjA1 c.51.1.1 * 1.1e-18 31.9 %
:RPS:PFM   31->183 PF00587 * tRNA-synt_2b 1e-08 35.6 %
:HMM:PFM   27->187 PF00587 * tRNA-synt_2b 1e-22 21.5 144/173  
:HMM:PFM   346->431 PF03129 * HGTP_anticodon 2.5e-12 27.9 86/94  
:BLT:SWISS 1->420 SYH_HALOH e-106 46.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54580.1 GT:GENE ACV54580.1 GT:PRODUCT histidyl-tRNA synthetase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 758912..760285 GB:FROM 758912 GB:TO 760285 GB:DIRECTION + GB:PRODUCT histidyl-tRNA synthetase GB:NOTE KEGG: acp:A2cp1_2445 histidyl-tRNA synthetase; TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H P and S); Anticodon-binding domain protein GB:PROTEIN_ID ACV54580.1 GB:DB_XREF GI:257474260 InterPro:IPR002314 InterPro:IPR004154 InterPro:IPR006195 InterPro:IPR015807 LENGTH 457 SQ:AASEQ MALQAPEGTKDLLPDEAKFWAHFKATAADMFGRYGYVTIETPVFEQTELFVRGIGEATDVVSKEMFTAISGENLNKLLGGGTIKGKSRLSLRPEGTAGVVRAVVQHDLVPQGAAPAKLMYAGPMFRAERPQKGRQRQFNQVGVECLGAEDPSVDAEGIIMLMRFFAAIGIPVDATRLLVNSMGCEQCRPAYRDAVKAYMDAHADELCDECKRRAEINPLRAFDCKNPDCAAVMADAPKITEHLCDDCREHYDTVKAYLGGAGLSFEEDPKLVRGLDYYTRTVFEVQVTEGMGSQNAIGGGGRYDKLAEEVGGRPTPGFGFALGYERCALALQAAGYEFPAARRCDFFVACVDDSVRAEAFSLVQACRDAGLIGEMDHQHRSLKSQFKLADKLGAVVVAVLGPDELAAGQVKVRNMRTHQESAADLAALKKLLAHFGGEPFGGEADSLEAVLGKLEAR GT:EXON 1|1-457:0| BL:SWS:NREP 1 BL:SWS:REP 1->420|SYH_HALOH|e-106|46.4|403/419| SEG 422->433|aadlaalkklla| BL:PDB:NREP 1 BL:PDB:REP 4->420|1adjA|8e-75|41.1|397/420| RP:PDB:NREP 1 RP:PDB:REP 3->420|1adjA|1e-47|40.2|400/420| RP:PFM:NREP 1 RP:PFM:REP 31->183|PF00587|1e-08|35.6|135/170|tRNA-synt_2b| HM:PFM:NREP 2 HM:PFM:REP 27->187|PF00587|1e-22|21.5|144/173|tRNA-synt_2b| HM:PFM:REP 346->431|PF03129|2.5e-12|27.9|86/94|HGTP_anticodon| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00587|IPR002314| GO:PFM GO:0005524|"GO:ATP binding"|PF00587|IPR002314| GO:PFM GO:0005737|"GO:cytoplasm"|PF00587|IPR002314| GO:PFM GO:0006412|"GO:translation"|PF00587|IPR002314| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00587|IPR002314| RP:SCP:NREP 2 RP:SCP:REP 11->326|1usyA|1e-49|17.0|264/275|d.104.1.1| RP:SCP:REP 342->420|1wu7A1|3e-15|21.5|79/97|c.51.1.1| HM:SCP:REP 2->336|1kmmA2|2.7e-78|34.0|318/322|d.104.1.1|1/1|Class II aaRS and biotin synthetases| HM:SCP:REP 341->435|1adjA1|1.1e-18|31.9|94/96|c.51.1.1|1/1|Class II aaRS ABD-related| OP:NHOMO 1192 OP:NHOMOORG 1024 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111-11 111-111111111111111-11111111111111111111------11-1-1----1111---1111111111111111112111111111111111--1-1111111111111111111111111111111111122222112221211111122211111112111112111111111111211111111222222212212222223122-222222221111111113211111111111111111111111111111111122111111111111111111111111111111111111111111111111111111113113111111111121221111112111112111211221122221111111111111111--1111111111111111111111-11111111111-111111111111111-111111--111111111111112211211111111111111111111111111111-1111-111111111111111111111111111111111111111121111111111111111211111111111111111111111111111111211122212111111-1111111111111111111111111111111111111111111111111111111-1121111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111211111111111111111111111111111111111111111111111111111111111111--------1-111111-11111111111111111111111111111111 ----211-211---1--1------------------------------------11---111-----------11----1---------12------------1-2-1222--1--32111-2-222118G1-1-A111-21211-111-22-21-112-----------212111-2-H222-222412122223222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 421 STR:RPRED 92.1 SQ:SECSTR EEccccTTcccccHHHHHHHHHHHHHHHHHHHHTTcEEcccccEEEHHHHHHHHcTTcHHHHHcccEEEcTTcccEEEEccccccGcEEEEccccHHHHHHHHHHTHTGGGccccEEEEEEEEEEcccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHTTccccEEEEEEEEcccHHHHHHHHHHHHHHHGGGGGGccHHHHHHTTccGGGGTTcccHHHHHHHHTcccGGGGccHHHHHHHHHHHHHHHHTTccEEEcccccccccccccEEEEEEcccEcccccEEEEEEEcTTHHHHTTcccccEEEEEEEHHHHHHHHHHTTccccccccccEEEEEccHHHHHHHHHHHHHHTTTTccEEEccccccHHHHHHHHHHTTccEEEEEcHHHHHHTEEEEEETTTccEE#################################### DISOP:02AL 456-458| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHccccccccccccccccccHHHHHHHHHccccccccEEEEccccHHHHHHHHHHccccccccccEEEEEEEEEEccccccccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHccccHHHccEEEEEEEEccccccccEEcccccccHHHHcccccccEEEEEEcHHHHHHHHHHccccccccccccEEEEEccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEcHHHHHcccEEEEEcccccEEEEcHHHHHHHHHHHHcccccccHHHHHHHHHHHHcc //