[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54589.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  284/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.222.1
:113 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   30->98 1ybxB PDBj 7e-09 39.7 %
:RPS:SCOP  47->106 1j8bA  d.222.1.1 * 5e-14 37.3 %
:HMM:SCOP  18->112 1pugA_ d.222.1.1 * 8e-31 47.3 %
:RPS:PFM   27->107 PF02575 * DUF149 3e-14 46.9 %
:HMM:PFM   18->110 PF02575 * DUF149 7.3e-36 50.5 93/93  
:BLT:SWISS 31->112 Y035_BACHD 4e-22 56.1 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54589.1 GT:GENE ACV54589.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 771916..772257 GB:FROM 771916 GB:TO 772257 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE PFAM: conserved hypothetical protein; KEGG: dol:Dole_0541 hypothetical protein GB:PROTEIN_ID ACV54589.1 GB:DB_XREF GI:257474269 InterPro:IPR004401 LENGTH 113 SQ:AASEQ MSKRGGFPGGGGNMGAMMKQAQKMQAELARAQEEIKDMTFEATAGGGMVKVVANGDMTVDSIVIDPEAVDPEDVEMLQDMVAAAVNEALRGVSEISSQRLNAATGGLNIPGLM GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 31->112|Y035_BACHD|4e-22|56.1|82/103| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 16->43| SEG 5->26|ggfpggggnmgammkqaqkmqa| BL:PDB:NREP 1 BL:PDB:REP 30->98|1ybxB|7e-09|39.7|68/88| RP:PFM:NREP 1 RP:PFM:REP 27->107|PF02575|3e-14|46.9|81/93|DUF149| HM:PFM:NREP 1 HM:PFM:REP 18->110|PF02575|7.3e-36|50.5|93/93|DUF149| RP:SCP:NREP 1 RP:SCP:REP 47->106|1j8bA|5e-14|37.3|59/92|d.222.1.1| HM:SCP:REP 18->112|1pugA_|8e-31|47.3|91/94|d.222.1.1|1/1|YbaB-like| OP:NHOMO 288 OP:NHOMOORG 286 OP:PATTERN -------------------------------------------------------------------- -1---1------------------------------1----111---------------------1------------11111------------------------1-------------------1-1-11--111111---111------------------1--11---------------1--11-111111111111111111111111111111111111111111111111111111111-1111---1--1----1111----1---111----------11111111111-----------------------111---------1-111111111-11-1--1111111211-111111----1-----111111------1-------------------------1---1-------------1------------11111111111-1--1------------------1----------------11111---------------------------------1------------111--1---------1-1--111111111-1111111111111211111-11-------------------------11---1-111-11-111111-1111-1--1-----1-11------------------------------------------------11---------------------------1--------------------1111--1-1------------11-111111-11-1--------------1------------1----111111111111111111111111-1--------------------------------------------------------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 74.3 SQ:SECSTR ##########################cccHHHHHHHHcEEEEEETTTTEEEEEETTccEEEEEEcGGGccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccTTccc### PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEcccEEEEEEEccccEEEEEEcHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //