[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54594.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->175 PF04976 * DmsC 7.5e-15 27.7 173/276  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54594.1 GT:GENE ACV54594.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 778085..778900 GB:FROM 778085 GB:TO 778900 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: dvm:DvMF_1610 anaerobic dimethyl sulfoxide reductase subunit C GB:PROTEIN_ID ACV54594.1 GB:DB_XREF GI:257474274 LENGTH 271 SQ:AASEQ MTIQWSLVLFTVLSGCGAGLFACTALDEFRGGAASKVRLPACAVAVALLVVGGIASATHLSHVDRMMAVLAHPTAGIFLEALLLGLLAVCIAVYALLVKREASSGARKALAATGIVLAVAFAFACGVSYMMTSRPVWNTVALPLAYLGTALATGAALYLVMCAALKVDEGDVKKAGVYAAAGGALSLVLTVAFGLVSGTAFGDQAALFWVAVVLCGSAAPAVCGVLVARKSGGALSLGVVALAGALVGSVAVRAVMWLVGTAVANYFGFAL GT:EXON 1|1-271:0| TM:NTM 8 TM:REGION 4->26| TM:REGION 38->60| TM:REGION 72->94| TM:REGION 109->131| TM:REGION 142->164| TM:REGION 176->198| TM:REGION 206->228| TM:REGION 241->263| SEG 41->51|acavavallvv| SEG 79->88|lealllglla| SEG 141->159|alplaylgtalatgaalyl| SEG 175->192|agvyaaaggalslvltva| SEG 231->252|sggalslgvvalagalvgsvav| HM:PFM:NREP 1 HM:PFM:REP 3->175|PF04976|7.5e-15|27.7|173/276|DmsC| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------3------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 271-272| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //