[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54612.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.138.1
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->122 1p2hA PDBj 7e-07 44.6 %
:HMM:SCOP  57->122 1d4cA1 a.138.1.3 * 2.1e-05 27.0 %
:HMM:PFM   59->106 PF09699 * Paired_CXXCH_1 6.6e-07 32.4 37/41  
:BLT:SWISS 63->122 FRDA_SHEFR 2e-06 44.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54612.1 GT:GENE ACV54612.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 801550..801927 GB:FROM 801550 GB:TO 801927 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: ank:AnaeK_1781 hypothetical protein GB:PROTEIN_ID ACV54612.1 GB:DB_XREF GI:257474292 InterPro:IPR011031 LENGTH 125 SQ:AASEQ MLNVKRSTVGALSTVALVLCLTLGLAACASQTSEPGADADGSSAKTTQTAAGDGTGAYVSDEQCLSCHGGSYEALAETTSSYEQSNPHDSLHGGYNSCVNCHARDKEITDNQCMHCHDWPHNPAA GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 63->122|FRDA_SHEFR|2e-06|44.6|56/571| TM:NTM 1 TM:REGION 7->29| SEG 44->57|akttqtaagdgtga| BL:PDB:NREP 1 BL:PDB:REP 63->122|1p2hA|7e-07|44.6|56/568| HM:PFM:NREP 1 HM:PFM:REP 59->106|PF09699|6.6e-07|32.4|37/41|Paired_CXXCH_1| HM:SCP:REP 57->122|1d4cA1|2.1e-05|27.0|63/0|a.138.1.3|1/1|Multiheme cytochromes| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 48.8 SQ:SECSTR #############################################################HHHHHHHccHHHcHHHTTcTcccccTTTccccccccGGGTccccccccccGGGGTcccccc### DISOP:02AL 17-17,20-20,25-46| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccc //