[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54625.1
DDBJ      :             WbqC-like family protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  68/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:240 amino acids
:PSIPRED
:RPS:PFM   8->227 PF08889 * WbqC 1e-44 41.9 %
:HMM:PFM   8->228 PF08889 * WbqC 1.7e-62 40.6 217/219  
:BLT:SWISS 1->224 Y1507_MYCTU 2e-23 32.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54625.1 GT:GENE ACV54625.1 GT:PRODUCT WbqC-like family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 816866..817588 GB:FROM 816866 GB:TO 817588 GB:DIRECTION + GB:PRODUCT WbqC-like family protein GB:NOTE PFAM: WbqC-like family protein; KEGG: gbm:Gbem_3729 WbqC-like family protein GB:PROTEIN_ID ACV54625.1 GB:DB_XREF GI:257474305 InterPro:IPR014985 LENGTH 240 SQ:AASEQ MKTVAMHQPHYFPWLGYLDKMAKADEFVVLDEVQFEDGSPMSRNRFLQVDGEAKLLSLSVEKKGYLEKPTRDVRLSNWPKTRKKHRGFIDCNYRKTPYFDEVMPLVAKVLEADCDTLLDLDMASIEMLRSAYGIETPLVLQSSLPYDIEAKNNDLVLGLCRVCGADVYLSGRGARAYMDDRSFAEKGIAVRYQEFSYPEYPQYRQSGFVPNLSALDPLFQCGIDGARRMFNENMRKEMIP GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 1->224|Y1507_MYCTU|2e-23|32.4|216/100| RP:PFM:NREP 1 RP:PFM:REP 8->227|PF08889|1e-44|41.9|215/219|WbqC| HM:PFM:NREP 1 HM:PFM:REP 8->228|PF08889|1.7e-62|40.6|217/219|WbqC| OP:NHOMO 70 OP:NHOMOORG 69 OP:PATTERN -----------------------------------------------1-------------------- ------------------------1-11111---------------------------------------1---------1---------1----------11----11-----------------------1------------------------------------1----1------------------1-------------1---------1------1------1----------------------------------------------------------------------------------------------------1-------------------------1------------------11-----------------------------------------1------1-1-1--------------1-----------------1-------------------------------------1--111--1---------------1-----1--11---1------------------------1-1-1-----1----1111--1------------1--------------------------------------1-------1--1----1---1--------------1---------------------------------------11----------------------------------------------------------1-------------------------------1-------111-1--------------------------------------------11------------------------------------------1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEccccccHHHHHHHHHHccEEEEEEEcEEEEcccccccEEccccccEEEEEEEEccccccccccEEEEEcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHHHcccEEEcccHHHHcccHHHHHHcccEEEEEcccccccccccccccccccHHHHHHHHccHHHHHHHHcccHHHHHcc //