[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54630.1
DDBJ      :             Acetyltransferase (isoleucine patch superfamily)- like protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  212/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
b.81.1
:225 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   77->215 2p2oD PDBj 5e-15 35.9 %
:RPS:PDB   65->215 3eh0A PDBj 3e-14 14.6 %
:RPS:SCOP  94->214 1khrA  b.81.1.3 * 1e-16 27.5 %
:HMM:SCOP  28->216 1t3dA_ b.81.1.6 * 6.9e-20 21.3 %
:HMM:PFM   166->183 PF00132 * Hexapep 6.8e-06 55.6 18/18  
:BLT:SWISS 128->216 ATRF2_STAHJ 1e-14 42.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54630.1 GT:GENE ACV54630.1 GT:PRODUCT Acetyltransferase (isoleucine patch superfamily)- like protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 822350..823027 GB:FROM 822350 GB:TO 823027 GB:DIRECTION + GB:PRODUCT Acetyltransferase (isoleucine patch superfamily)- like protein GB:NOTE KEGG: acb:A1S_0057 capsular polysaccharide synthesis enzyme GB:PROTEIN_ID ACV54630.1 GB:DB_XREF GI:257474310 InterPro:IPR001451 LENGTH 225 SQ:AASEQ MEVKKGGLEEDHQSSSLKEKIVNRKKPIHLFILNGIDAFFVFGFVKVFGILAYDRKFLSGKQFEHFWSPGWRWAFNGMIRKLLTGHGRGIPWPIGRSCDCGRNVDFHIDDLNNFNGTALFQTFGNARIRVGRGVWIARGCSLITANHDLADPDVHAEPQNIDLGDHCWLGANVVITPGVVLGPHTVVGANAVVTKGFPEGHCVLGGVPAKVIKRLDNTLEKEADR GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 128->216|ATRF2_STAHJ|1e-14|42.0|88/192| SEG 39->49|ffvfgfvkvfg| BL:PDB:NREP 1 BL:PDB:REP 77->215|2p2oD|5e-15|35.9|131/183| RP:PDB:NREP 1 RP:PDB:REP 65->215|3eh0A|3e-14|14.6|151/341| HM:PFM:NREP 1 HM:PFM:REP 166->183|PF00132|6.8e-06|55.6|18/18|Hexapep| RP:SCP:NREP 1 RP:SCP:REP 94->214|1khrA|1e-16|27.5|120/206|b.81.1.3| HM:SCP:REP 28->216|1t3dA_|6.9e-20|21.3|183/262|b.81.1.6|1/1|Trimeric LpxA-like enzymes| OP:NHOMO 376 OP:NHOMOORG 270 OP:PATTERN ---------------------------------1----------1-----111--------------- ----211-111-1-------------------------11-----1---1---2----------1----121222-11--2-------6423-3-----1-1-1-112-1-----------------------11-------------2-----------------2113-------------------------------------1--111-1----11-2-1-----1-2-112221211111111--1-113----11-1331111112---4231111---1--1---1------1----1-------1--------2----2-------1-1----------11----------------------3-----------------------------------1------21---1-2------1-121---------------11111111------------------------------------------------------1----------------21-------1------------------------------1------1-1-1--11-1---1--1----1-1---------------1--------------3311-1----1-3111--211--1111-22-------------11---2-11111111---111-111-1111111-11-111-1-------------------1------------------------1-----------2----11----------111111------2---------111-1-------------222------22234-----------------2----1-------------------------------------------------1 ----3---------1--2222222-2211-1111--1111-11----2--22113111----21--11111--1-111-1-------1-----------------2---------------------------------------------------------1---------------5--1------1-----432- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 78.2 SQ:SECSTR #################################################EEHHHHHHHHHTTTTEcTTcEEccccEEcTTcEEEEccccEEEETTEEEEccccccEEEccccEEcTTcEEEccccccEEEcTTcEEcTTcEEcTTcEEcTTcEEcTTcETEEEcTTcEEcTTcEEcccEEEcccEEEcTTcEEcccccccEEEccccccccHHHHccHHHHHHHH PSIPRED cccccccccccHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHHHHHHHcccHHHccHHHHcccccHHHHHHHHHHHHHHccccccccEEEcccEEEEccccEEccccEEccccEEEEEEEccccEEEccccEEccccEEEccccccccccccccccccEEccccEEccccEEcccEEEccccEEccccEEEEccccccEEEEEcccEEEEEccHHHHHHHcc //