[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54643.1
DDBJ      :             extracellular solute-binding protein family 3
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  399/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:276 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   65->272 3hv1B PDBj 8e-19 29.1 %
:RPS:PDB   65->264 3delB PDBj 2e-22 17.2 %
:RPS:SCOP  65->264 1ii5A  c.94.1.1 * 1e-23 18.4 %
:HMM:SCOP  1->270 2a5sA1 c.94.1.1 * 1.2e-52 33.5 %
:RPS:PFM   67->264 PF00497 * SBP_bac_3 8e-15 31.6 %
:HMM:PFM   45->265 PF00497 * SBP_bac_3 1.2e-55 31.6 215/225  
:HMM:PFM   13->39 PF01298 * Lipoprotein_5 6.9e-05 51.9 27/593  
:BLT:SWISS 66->272 YXEM_BACSU 2e-13 28.9 %
:PROS 67->80|PS01039|SBP_BACTERIAL_3
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54643.1 GT:GENE ACV54643.1 GT:PRODUCT extracellular solute-binding protein family 3 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 838959..839789 GB:FROM 838959 GB:TO 839789 GB:DIRECTION + GB:PRODUCT extracellular solute-binding protein family 3 GB:NOTE PFAM: extracellular solute-binding protein family 3; SMART: extracellular solute-binding protein family 3; KEGG: ajs:Ajs_0743 extracellular solute-binding protein GB:PROTEIN_ID ACV54643.1 GB:DB_XREF GI:257474323 InterPro:IPR001638 LENGTH 276 SQ:AASEQ MKKKLVALAAAVATLALSAVMLAGCSGGGDAQSADSAATDGSFTLAVGFDQGYPPYGYVGDDGQFTGFDLELAKAVCEKMGWELKLEPIDWDAKDALIGSGTINCIWNGFTMENRENDYTFSEPYMYNEQVVVVKKDSDAKKLEDLAGKTVLTQVDSAALHVLEDEKGQKALADTFKELQTIGDYNNAFMQLESGMVDAVACDLSIASYQMAAKPDTYVKLGVLAPENYAVGFKKGDTELAKQVTDALKALDEDGTVKQLCDKYADQGITYDNWVL GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 66->272|YXEM_BACSU|2e-13|28.9|201/264| PROS 67->80|PS01039|SBP_BACTERIAL_3|PDOC00798| TM:NTM 1 TM:REGION 5->27| SEG 5->42|lvalaaavatlalsavmlagcsgggdaqsadsaatdgs| SEG 50->64|dqgyppygyvgddgq| SEG 131->142|vvvvkkdsdakk| BL:PDB:NREP 1 BL:PDB:REP 65->272|3hv1B|8e-19|29.1|203/249| RP:PDB:NREP 1 RP:PDB:REP 65->264|3delB|2e-22|17.2|192/232| RP:PFM:NREP 1 RP:PFM:REP 67->264|PF00497|8e-15|31.6|190/222|SBP_bac_3| HM:PFM:NREP 2 HM:PFM:REP 45->265|PF00497|1.2e-55|31.6|215/225|SBP_bac_3| HM:PFM:REP 13->39|PF01298|6.9e-05|51.9|27/593|Lipoprotein_5| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 65->264|1ii5A|1e-23|18.4|190/222|c.94.1.1| HM:SCP:REP 1->270|2a5sA1|1.2e-52|33.5|254/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 686 OP:NHOMOORG 415 OP:PATTERN -----1-----------------12-----1111-----122---111----1----1---------- ---------------------2---2------21111-11----2-1--1--1111--------1-1-1-1-111111-1321--------------------------1-------------------------------111---------------------1------------------1---1---23-----11-11-1---312233-2112123-4222221711111111111111111--11311122113-3223323142112---2221122-33444444444342222122222222233433333212132222222212122332333-311-32-2133-3-2--111111124-------------------------22212132234---------11-----11---1-11---------------11111111-11----------------------------------------13112122222-----22-11111-1413121--------2211-121---2-----12222222--------1--31323522522-2--2------------211---------------------------1-------1111---111111--1---------------12111111111111111-111111111111111111111111---121221322132222321-11111-111111111-111--1-------------4-----1----------------------11112111122222222----------111----------------------------3--------------2-1-------------------------11--11-111--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 76.4 SQ:SECSTR ################################################################EEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEccccccHHHHTTEEEEEEEEEEcEEEEEEEccccccccGGGcccEEEETTcHHHHHHHHcTTHHHHHTTcccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTHTTTcccccEE# PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccEEEEEEEcccccEEEEcccccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccEEEccEEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHccccEEEEEcHHHHHHHHHHccccEEEccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccEEc //