[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54668.1
DDBJ      :             fumarate reductase/succinate dehydrogenase flavoprotein domain protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  166/915 : Eukaryota  51/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.168.1
:503 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   76->497 1qo8A PDBj 5e-41 33.2 %
:RPS:PDB   76->497 1d4cB PDBj 9e-40 30.2 %
:RPS:SCOP  76->327 1d4cA2  c.3.1.4 * 1e-19 22.0 %
:RPS:SCOP  310->428 1d4cA3  d.168.1.1 * 2e-15 26.3 %
:HMM:SCOP  45->498 1jnrA2 c.3.1.4 * 7.3e-49 34.4 %
:RPS:PFM   76->471 PF00890 * FAD_binding_2 2e-18 38.2 %
:HMM:PFM   50->473 PF00890 * FAD_binding_2 4.5e-65 34.3 385/421  
:BLT:SWISS 76->497 FRD2_SHEFN 1e-40 33.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54668.1 GT:GENE ACV54668.1 GT:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 868352..869863 GB:FROM 868352 GB:TO 869863 GB:DIRECTION + GB:PRODUCT fumarate reductase/succinate dehydrogenase flavoprotein domain protein GB:NOTE PFAM: fumarate reductase/succinate dehydrogenase flavoprotein domain protein; HI0933 family protein; FAD dependent oxidoreductase; FAD-dependent pyridine nucleotide-disulphide oxidoreductase; KEGG: sfr:Sfri_2586 flavocytochrome c GB:PROTEIN_ID ACV54668.1 GB:DB_XREF GI:257474348 InterPro:IPR003953 InterPro:IPR004792 InterPro:IPR006076 InterPro:IPR006311 InterPro:IPR013027 LENGTH 503 SQ:AASEQ MERIEGDLSRRGFVGAAFAGAMGIAAASVLSGCSAGGSSAADGDWTETFDVVVVGSGAGGHAAAIEAAKAGAKVVLLEKENGLGGDSAVCDGIVSGWGTRLAKAQGIDVSPDEIYDWFMAHSEWFGAIDPEVARLNADKCGETIDWLEELGVPFEEEVGPRMSYTDLPVVHQVVGKGGAMVSAMTAAAESAGVSIETKTAVTKLVKDADGRVVGVEAMKGRERVRIKAEKGVVLATGGYSGSTDMLVALCPANKNLKASGAAGLTGDGLTMASDAGVFTTRTSWQPLMSPVAGAATKSPVLIDYSERLNGLLLDENGERFCNEGRQYFGRALAIDVLAKQNEQDGKEVVLMIPTTPELEKLLSVREIVWPCGDTVEEVAEQVGLDPAKVKATVERYNGFVEAGLDEDFGRSGEHLVPMTGPFYAAPVTVSTSMTIGGVKINTNGEALKLASSGKGDVTLEPVPGLYATGEVCEWNCASGWTVLSAVTIGRIAGQNAAAEGSAS GT:EXON 1|1-503:0| BL:SWS:NREP 1 BL:SWS:REP 76->497|FRD2_SHEFN|1e-40|33.2|397/588| SEG 12->43|gfvgaafagamgiaaasvlsgcsaggssaadg| SEG 51->75|vvvvgsgagghaaaieaakagakvv| BL:PDB:NREP 1 BL:PDB:REP 76->497|1qo8A|5e-41|33.2|397/564| RP:PDB:NREP 1 RP:PDB:REP 76->497|1d4cB|9e-40|30.2|401/566| RP:PFM:NREP 1 RP:PFM:REP 76->471|PF00890|2e-18|38.2|322/375|FAD_binding_2| HM:PFM:NREP 1 HM:PFM:REP 50->473|PF00890|4.5e-65|34.3|385/421|FAD_binding_2| GO:PFM:NREP 2 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00890|IPR003953| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00890|IPR003953| RP:SCP:NREP 2 RP:SCP:REP 76->327|1d4cA2|1e-19|22.0|250/322|c.3.1.4| RP:SCP:REP 310->428|1d4cA3|2e-15|26.3|114/146|d.168.1.1| HM:SCP:REP 45->498|1jnrA2|7.3e-49|34.4|288/357|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 567 OP:NHOMOORG 218 OP:PATTERN ------------------------------1------------------------------------- --------223---45511-15--251-111256664977-2-2----------1-----118----------------7cD-----------------------------------------------------------------------------------------------------1-------------------------1---------------111111------------------11--12-411214124411-1-11-1-111--------11-------------------------21---1112-B6-2------------------24-2------KG-----1-------1---------------223----1-1---------------1--4--2-1-1-----------121--1-----1--------------------------------------------------64--2432----11---------2------1-3-21------1-----1---1-----------------------1---1---------21151-1--11-1---1-231-----------------1-------1------1-22431-6733343772683---------------32-11------------------------------12221------------------------------------------------------------------------------------3------11---111-----------------------1----------------------------------------------------------------------------- ------1-433--1-1-----111---------111------------1--24---11111--111--------------------11-252-1211-11121112---------------------------------------------------------1-------21----11M312----1----1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 428 STR:RPRED 85.1 SQ:SECSTR ###########################################################################EEcccccccTTGGGccccEEccccHHHHHTTccccHHHHHHHHHHHTTTccTccHHHHHHHHHHHHHHHHHHHHTTccccEcTTcccccEEEcEccccccHHHHHHHHHHHHHHHTTcEEEccEEEEEEEEcccccEEEEEEEETTTEEEEEEccEEEEcccccTTcHHHHHHHcGGGTTcEEcccTTcccHHHHHHHTTTccEEcEEcTTcTTcEEEEEEEcTccccTHHHHTTEEEcccccccccTTccHHHHHHHHHHHHHTcTTccEEEEEEHHHHHHcTHHHHHHHTTccEEccHHHHHHHHTccHHHHHHHHHHHHHHHHHTccccccccccccccccccEEEEEEEEEEEEEccEEEccTTcEEEcTTcTcEcTTTccEEEEEEEccTTcTTcccTTHHHHHHHHHHHHHHHHHHHHHHHc PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccHHHHccccccccccHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccccccccccccHHHHHHHHHHHHHHcccEEEcccEEEEEEEcccccEEEEEEEEccEEEEEEEcccEEEcccccccHHHHHHHHccccccccccccccccHHHHHHHHHccccccccEEEEEccccccccccccEEEEEcccccEEEEcccccEEcccccccccHHHHHHHHHHcccccccEEEEcccccHHHHHHHHcccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEEEEcccEEEccccEEEEccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //