[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54670.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->84 1ea2A PDBj 1e-04 14.3 %
:RPS:SCOP  2->58 3cu3A1  d.17.4.28 * 1e-04 22.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54670.1 GT:GENE ACV54670.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(871712..872059) GB:FROM 871712 GB:TO 872059 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54670.1 GB:DB_XREF GI:257474350 LENGTH 115 SQ:AASEQ MVINDFVSAMQSKDHEALAACFAEECRLFDYCPSVVKRQNSFLFGRNAIEMYYHNKFMFGGFGMLDPRVVNERTVNFYADYNGTIIHALAQIENCTDGSCSLDDSLIRELVIRPA GT:EXON 1|1-115:0| RP:PDB:NREP 1 RP:PDB:REP 2->84|1ea2A|1e-04|14.3|77/123| RP:SCP:NREP 1 RP:SCP:REP 2->58|3cu3A1|1e-04|22.0|50/162|d.17.4.28| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 94.8 SQ:SECSTR #HHHHHHHHHHHTcHHHHHHHEEEEEEEEccTTcccEETcccEEHHHHHHHHHHHHcccEEEEccccEEccccEEEEEEEEEEEETTTccEEEEEEEEEEEEETTEEEEE##### DISOP:02AL 17-18,20-20,25-25,39-39,45-46,48-48,53-53,73-73,101-101,115-116| PSIPRED ccHHHHHHHHHccHHHHHHHHHHHHccHHHHcHHHHHccccEEEcccEEEEEEEccEEEcccccccHHHccccEEEEEEccccHHHHHHHHHcccccccccccHHHHHHHHcccc //