[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54674.1
DDBJ      :             ApbE family lipoprotein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  503/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.96.2
:379 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   139->324 1vrmA PDBj 2e-30 44.7 %
:RPS:SCOP  138->324 1vrmA1  d.96.2.1 * 7e-54 42.9 %
:HMM:SCOP  56->368 1vrmA1 d.96.2.1 * 3.2e-84 43.4 %
:RPS:PFM   139->324 PF02424 * ApbE 1e-47 53.0 %
:HMM:PFM   94->336 PF02424 * ApbE 7.8e-77 45.4 240/252  
:HMM:PFM   7->95 PF10099 * RskA 1.2e-06 29.9 87/175  
:BLT:SWISS 138->324 APBE_TREPA 2e-35 44.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54674.1 GT:GENE ACV54674.1 GT:PRODUCT ApbE family lipoprotein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(873945..875084) GB:FROM 873945 GB:TO 875084 GB:DIRECTION - GB:PRODUCT ApbE family lipoprotein GB:NOTE PFAM: ApbE family lipoprotein; KEGG: bbr:BB3282 thiamine biosynthesis protein GB:PROTEIN_ID ACV54674.1 GB:DB_XREF GI:257474354 InterPro:IPR003374 LENGTH 379 SQ:AASEQ MVKRFARQNRTTRSSRRSWTGRAFAALLACALGAALAVGPVGCAGGEPDGADVPTTTATSSFTAMDTGMTLTVHAASQAVADDAANACRQRVLELDELLAPENAASEIARANAAGGAPTAVSPATAALVAASLDAASQTGGAFDPTVYPLTSAWGFTTGDHRVPSTDELAALLPRVGYAAVQVDETAGTVTLEGGAQIDVGGVAKGFAADELRALLRERDITSALFDLGGNVTALGSKPDGSPWKVGVADPDDPGKLAGLLEVRDATVSTSGAYQRYFEGKDGTRYHHLLDPSTGYPAASDLASASVVGADGAQCDALSTACFVLGLDGALDLWRAAAADGDAAFDLVLIASDGRTFVTDSIADAYTPAAGTNAQVVRS GT:EXON 1|1-379:0| BL:SWS:NREP 1 BL:SWS:REP 138->324|APBE_TREPA|2e-35|44.1|186/362| SEG 10->22|rttrssrrswtgr| SEG 25->46|aallacalgaalavgpvgcagg| SEG 75->87|aasqavaddaana| SEG 104->136|aaseiaranaaggaptavspataalvaasldaa| SEG 325->347|lgldgaldlwraaaadgdaafdl| BL:PDB:NREP 1 BL:PDB:REP 139->324|1vrmA|2e-30|44.7|179/304| RP:PFM:NREP 1 RP:PFM:REP 139->324|PF02424|1e-47|53.0|185/253|ApbE| HM:PFM:NREP 2 HM:PFM:REP 94->336|PF02424|7.8e-77|45.4|240/252|ApbE| HM:PFM:REP 7->95|PF10099|1.2e-06|29.9|87/175|RskA| GO:PFM:NREP 1 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF02424|IPR003374| RP:SCP:NREP 1 RP:SCP:REP 138->324|1vrmA1|7e-54|42.9|184/309|d.96.2.1| HM:SCP:REP 56->368|1vrmA1|3.2e-84|43.4|304/0|d.96.2.1|1/1|ApbE-like| OP:NHOMO 665 OP:NHOMOORG 509 OP:PATTERN -------------------------------------------------11----------------- --3-1--------------------------------1--112-----------1---------2--1----------1232---1--1111-2111---131123-4-111111111111111111-1-112-21111111111-------------------------------------------11-2---------------------------------11111111----------------11--21-144-1111331133-112-122211111-11111111111111111111111111111221112221112251111111-1-2111122-12111121--22---121--1111-1-1-21111-------1-111212-1222222121221-11311211-1---------1---1-211-2-21111-11-------------12---------------------------------1-1-1-12-------2111----222212---1223--11222-2212-11-111111--112111111--211-11111111-311-----1---1-1111-111--------------------1--11--222124212112222213422223423242--12112-1----11221221111111111-1111111111111111111222221111111111111111111211111111-111111111111---2---------22213111111111111111-------111121111111-111211111---------1111111111211111111111---11111111--------------111-------------------------1111111111-11 --------211--------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 49.1 SQ:SECSTR ########################################################################################################################################HHTTTcccTTTHHHHHHHTTTccGcccccHHHHHHHHTTccGGGEEEETTTEEEEEcTTcccccTTTHHHHHHHHHHHHHHHHcTTcEEEEETTEEEEEEccTTTccEEEEEEcTccc#cEEEEEEEcccEEEEEETTccEEE#ETTEEEEccccTTTcccccccEEEEEEEEccHHHHHHHHHHHHH####################################################### DISOP:02AL 8-15,17-18| PSIPRED ccHHHHHccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccEEccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccHHHHHHHHHHccHHHEEEEccccEEEEccccEEEEccHHHHHHHHHHHHHHHHccccEEEEEcccEEEEEEcccccccEEEEEEcccccccEEEEEEEcccEEEEccccccEEEEcccEEEEEEEcccccccccccEEEEEEEccccHHHHHHHHHHHHccHHHHHHHHHHHHHcccccEEEEEEcccccEEEcHHHHHHcccccccccEEEEc //