[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54683.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:143 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   77->123 PF04976 * DmsC 0.00013 31.1 45/276  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54683.1 GT:GENE ACV54683.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(881502..881933) GB:FROM 881502 GB:TO 881933 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE KEGG: rme:Rmet_5748 protein of unknown function DUF6, transmembrane GB:PROTEIN_ID ACV54683.1 GB:DB_XREF GI:257474363 LENGTH 143 SQ:AASEQ MKKIIAQTATAVCIVFTVMMAWFLAMGYLFAGPSYGLNLTASLYGAAFGMAALQAIWFTGALIKKLPYPARIAGFGACLLPVLALCAWLGQWLPAEDPGAWASFVVIYLFILAGMTAGYTVYYKKTAGGYDEALARYREQNRR GT:EXON 1|1-143:0| TM:NTM 4 TM:REGION 7->29| TM:REGION 42->63| TM:REGION 71->93| TM:REGION 101->119| HM:PFM:NREP 1 HM:PFM:REP 77->123|PF04976|0.00013|31.1|45/276|DmsC| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-32,34-34,39-40,45-46,48-48,53-54,59-59,95-95,143-144| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHcc //