[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54701.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:38 amino acids
:PSIPRED
:HMM:PFM   15->35 PF10981 * DUF2788 0.00088 42.9 21/52  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54701.1 GT:GENE ACV54701.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 909752..909868 GB:FROM 909752 GB:TO 909868 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54701.1 GB:DB_XREF GI:257474381 LENGTH 38 SQ:AASEQ MTLFGITVPMEAIWVIVAIIVLVIVGFIAKGFIDEMKK GT:EXON 1|1-38:0| TM:NTM 1 TM:REGION 7->29| SEG 12->29|aiwvivaiivlvivgfia| HM:PFM:NREP 1 HM:PFM:REP 15->35|PF10981|0.00088|42.9|21/52|DUF2788| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //