[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54702.1
DDBJ      :             sortase, SrtB family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.100.1
:357 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   147->325 1rz2A PDBj 2e-22 33.5 %
:RPS:SCOP  132->312 1ng5A  b.100.1.1 * 1e-14 27.8 %
:HMM:SCOP  93->335 1qwzA_ b.100.1.1 * 1e-34 29.1 %
:RPS:PFM   159->266 PF04203 * Sortase 3e-11 40.4 %
:HMM:PFM   159->324 PF04203 * Sortase 2.2e-12 22.0 118/128  
:HMM:PFM   81->125 PF05134 * GspL 0.00012 20.0 45/358  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54702.1 GT:GENE ACV54702.1 GT:PRODUCT sortase, SrtB family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 910012..911085 GB:FROM 910012 GB:TO 911085 GB:DIRECTION + GB:PRODUCT sortase, SrtB family GB:NOTE TIGRFAM: sortase, SrtB family; KEGG: bha:BH3294 hypothetical protein GB:PROTEIN_ID ACV54702.1 GB:DB_XREF GI:257474382 InterPro:IPR009835 LENGTH 357 SQ:AASEQ MSEYRQHPGPAPSGRPAQQRVPRGAAPDVRAGAQPGAYRPATAQHAAYRSAQPAQRRSAGGGGYPYRQQPTYQQPGSGRPRKKSGPWRVVFWIALVVFVVALAALGAIGFSYWQGQQTYNDVAREGFTPPDDLSATSLADFTVDWDALKAINPDTVGWIYIPGTVVNYPIVQAADDEKYLTHDFKGSEGWIATFGAIFLAAENSSDFSDPNNIIYGHHLNDGSMFACVADFSDAAQFNDHRTVYILTPEGNYELSTFALVHVAADDPLAQMRFADEDERVAYVQDKIDRSVVPASDIPAASDIKHTFALATCDNLPSDGRYVLYSYVKASTVGEGDGDVIDPDAVAAIDSAEQEIAS GT:EXON 1|1-357:0| TM:NTM 2 TM:REGION 89->110| TM:REGION 154->176| SEG 60->76|ggggypyrqqptyqqpg| SEG 89->110|vvfwialvvfvvalaalgaigf| SEG 335->349|gdgdvidpdavaaid| BL:PDB:NREP 1 BL:PDB:REP 147->325|1rz2A|2e-22|33.5|170/214| RP:PFM:NREP 1 RP:PFM:REP 159->266|PF04203|3e-11|40.4|89/126|Sortase| HM:PFM:NREP 2 HM:PFM:REP 159->324|PF04203|2.2e-12|22.0|118/128|Sortase| HM:PFM:REP 81->125|PF05134|0.00012|20.0|45/358|GspL| RP:SCP:NREP 1 RP:SCP:REP 132->312|1ng5A|1e-14|27.8|176/211|b.100.1.1| HM:SCP:REP 93->335|1qwzA_|1e-34|29.1|230/235|b.100.1.1|1/1|Sortase| OP:NHOMO 70 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1134----------------------------------------------------------------------------------------------------------------11111111-11111111--1-111---1---111111---1111111111111-----------------------------------1---1----------2--1111-11--21111-----------------------------11----1--11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 49.9 SQ:SECSTR ################################################################################################################################################HHHHHHHcTTEEEEEEcTTcccEEEEEEcccccTTTTccTTccc###cTTccEEEcTTccTTccccEEEEEEcccTTcTcTGGGGGGGcHHHHHTccEEEEEEcccEEEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHccccccccccTTccEcEEEEEEcccTTTcccEEEEE################################ DISOP:02AL 357-358| PSIPRED cccHHcccccccccccHHHHcHHHccccccccccccccccccHHHHHHHcccHHHHccccccccccccccHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccEEEEEEEccEEEEEEEEEccccHHHHccccccccccccccccEEEEEEcccccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEEEEEcccccEEEcccccHHHHHHHHHHHHHHccEEcccccccccccEEEEEEEccccccccEEEEEEEEEEEccccccccEEcHHHHHHHHHHHHHHcc //