[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54715.1
DDBJ      :             thioesterase superfamily protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  157/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:140 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   7->126 1vi8G PDBj 1e-12 31.5 %
:RPS:PDB   3->116 3e1eC PDBj 3e-10 16.8 %
:RPS:SCOP  5->90 1zkiA1  d.38.1.5 * 2e-11 18.8 %
:HMM:SCOP  1->127 1vh9A_ d.38.1.5 * 7.5e-17 25.6 %
:HMM:PFM   33->87 PF03061 * 4HBT 8.6e-07 20.4 54/79  
:BLT:SWISS 7->126 YDII_ECOLI 4e-12 31.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54715.1 GT:GENE ACV54715.1 GT:PRODUCT thioesterase superfamily protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 929015..929437 GB:FROM 929015 GB:TO 929437 GB:DIRECTION + GB:PRODUCT thioesterase superfamily protein GB:NOTE PFAM: thioesterase superfamily protein; KEGG: bcy:Bcer98_3526 thioesterase superfamily protein GB:PROTEIN_ID ACV54715.1 GB:DB_XREF GI:257474395 InterPro:IPR003736 InterPro:IPR006683 LENGTH 140 SQ:AASEQ MALTDTLRIETVSADKRHVEATMPIVPEVFQPHGYLHGGATIALLETVASIGTEQNTDFDKERPFGIDVQVRHRKSGKEGTLRGVADLDREEVSERTGAVKQYWNVAAYDDAGDVVSDGVIMTKIVSLARLAQKEQERTS GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 7->126|YDII_ECOLI|4e-12|31.5|111/136| BL:PDB:NREP 1 BL:PDB:REP 7->126|1vi8G|1e-12|31.5|111/137| RP:PDB:NREP 1 RP:PDB:REP 3->116|3e1eC|3e-10|16.8|107/141| HM:PFM:NREP 1 HM:PFM:REP 33->87|PF03061|8.6e-07|20.4|54/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 5->90|1zkiA1|2e-11|18.8|85/126|d.38.1.5| HM:SCP:REP 1->127|1vh9A_|7.5e-17|25.6|117/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 157 OP:NHOMOORG 157 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1--------------------------------11------111--1-----1-111----1------------------------------11---1--------------------------------------1--11-----1111111111111111--11--1111-1----11111---11111111111111111111--------------------------------------------------------------------------------------------------1---------1--------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------1----------------------------------------------1111111111111111111-------------1------1111111111-1111111111111111111111----11111111111111111-1111111------------------11111-------------------------------------------------1-------------1111----------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 98.6 SQ:SECSTR cHHHHHHTcEEEEEETTEEEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHHTTccTTTcEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEEEccEEEEEEEcTTc## PSIPRED cccHHHccEEEEEEEccEEEEEEEccHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEccccccEEEEEEEEEEEEEEEEEccEEEEEEEEEEEccccEEEEEEEEEEEEEEcccHHHHHHccc //