[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54719.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  142/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:309 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   193->303 3flpA PDBj 8e-05 29.4 %
:RPS:SCOP  110->283 1iu4A  d.3.1.8 * 4e-16 5.9 %
:HMM:PFM   258->280 PF00960 * Neocarzinostat 0.00096 39.1 23/110  
:BLT:SWISS 64->287 MACA_SHIFL 3e-15 28.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54719.1 GT:GENE ACV54719.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 931908..932837 GB:FROM 931908 GB:TO 932837 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: aba:Acid345_1830 secretion protein HlyD GB:PROTEIN_ID ACV54719.1 GB:DB_XREF GI:257474399 LENGTH 309 SQ:AASEQ MKSIVGKSVTVVLLLAVASGLAAWLVFGDKISAALSGEPQTVSPLTAPVERGSVQQTVTGVGEVKPLETVKLRPADSWHWLQSFDAPLNKRVAADETLVTYANGEKWAAPYDLVVTSRELPEKNKGAVTKDDHYIEVQRIDTVSVTMEVSEKDLGLLSEGQSVKVKLGSDNGREYDGTISNINEVGTYGATGSKFTVTVKVPNDGSIKLGMSANLSITVAEASDVLTVPVSAVIGAGDDKFVQVYDLASGEQRAEPVTTGISNGTMVEVSGEGLKEGDLVVLNEAEPAGGGFSEGDAEEGPITVTPVLE GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 64->287|MACA_SHIFL|3e-15|28.3|223/371| TM:NTM 1 TM:REGION 7->29| SEG 9->26|vtvvlllavasglaawlv| BL:PDB:NREP 1 BL:PDB:REP 193->303|3flpA|8e-05|29.4|102/217| HM:PFM:NREP 1 HM:PFM:REP 258->280|PF00960|0.00096|39.1|23/110|Neocarzinostat| RP:SCP:NREP 1 RP:SCP:REP 110->283|1iu4A|4e-16|5.9|170/331|d.3.1.8| OP:NHOMO 160 OP:NHOMOORG 142 OP:PATTERN -------------------------------------------------------------------- 12--------------------------------------1--------------------------------------11-------1111-111---1-----11-------------------------1-1---------1----1--1----------1----------------------1112-----------------------------------222112--------------------------------------------------------------------------------------------12212--------------------------1-1113-1---21211------1----------1--1-111-11---------------------11-111-----1----------2---------------1----1-1-----------------------------------------------------------------1------1---2----1----2----------------1-2------------------1---1------1---------------------------------1-----------------------------1--------11-----1111111111-1111111111111111111111-----11-1-11111-11111-11-1111--1-------------------------11----------------1----------------1111--------1--------------------1---21----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 70.2 SQ:SECSTR ##################################################################################HHHHHHHHHHHHHHHHHHHHHTTEEEcccccccccccccccEEcccccccccEEEEEEEEEEEEEEEETTTTTcccccccEEEEETTcccccEEEcccccccccEEccccEEEEEEEEEcTTcEEEEEEEETEEEccTcccEEEEEEEEccTT####ccEEEEEEEETTTEEEEEETTEEEEEEccccTcccccccEEEEcccccTTccccGGGcccEEEE###### PSIPRED cccccccEEEEEEEEccccccEEEEEEccEEccccccccccccHHccHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEccccEEEEEEEEccccEEEccccccEEEEEEccEEEEEEEEcHHHHHHcccccEEEEEEEcccccEEEEEEEEEEccccccccEEEEEEEEEEccccccccccEEEEEEEEcccccEEEccHHHEEEcccccEEEEEEccccEEEEEEEEEEEEcccEEEEEEcccccccEEEEccccccccccccccccccccccccccc //