[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54728.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:32 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->20 PF03855 * M-factor 0.00045 40.0 20/44  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54728.1 GT:GENE ACV54728.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(944147..944245) GB:FROM 944147 GB:TO 944245 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54728.1 GB:DB_XREF GI:257474408 LENGTH 32 SQ:AASEQ MAEGFSPEQIVNAYAAPAESYWLRNRDDPALA GT:EXON 1|1-32:0| HM:PFM:NREP 1 HM:PFM:REP 1->20|PF03855|0.00045|40.0|20/44|M-factor| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,31-33| PSIPRED ccccccHHHHHHHHHccccHHHHccccccccc //