[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54741.1
DDBJ      :             Amidase
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  314/915 : Eukaryota  97/199 : Viruses  0/175   --->[See Alignment]
c.117.1
:374 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   72->216,243->369 1m22A PDBj 2e-23 40.3 %
:RPS:PDB   72->218,246->363 2dqnA PDBj 2e-27 29.5 %
:RPS:SCOP  72->218,243->369 1m21A  c.117.1.1 * 2e-33 42.5 %
:HMM:SCOP  67->242 1m22A_ c.117.1.1 * 1.7e-39 38.5 %
:HMM:SCOP  320->372 2f2aA1 c.117.1.1 * 1.3e-09 38.5 %
:RPS:PFM   92->218 PF01425 * Amidase 4e-17 47.9 %
:HMM:PFM   91->242 PF01425 * Amidase 5.8e-33 36.4 143/435  
:HMM:PFM   312->353 PF01425 * Amidase 5.4e-06 40.5 42/435  
:BLT:SWISS 74->217 GATA_LAWIP 1e-17 40.4 %
:BLT:SWISS 298->363 GATA_THIDA 4e-05 30.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54741.1 GT:GENE ACV54741.1 GT:PRODUCT Amidase GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(957072..958196) GB:FROM 957072 GB:TO 958196 GB:DIRECTION - GB:PRODUCT Amidase GB:NOTE PFAM: Amidase; KEGG: bcr:BCAH187_A2026 amidase family protein GB:PROTEIN_ID ACV54741.1 GB:DB_XREF GI:257474421 InterPro:IPR000120 LENGTH 374 SQ:AASEQ MKTRLKIILPASIILIALVGVAIAALALPRSLAPEQEERISYDKDQQVALIDSQLAGIDLEKVRAKKDLIMEKSIEDLHAAISRGDLTYEELTAFYLNRIKTYDAGEKGINAVAAINPKAIEEARALDASSATPAGMRGIPVLVKDNVNTNTMPTSGGTYALKDFTPKDDADVVTALTNSGAIILGKSNLSELANFMDTKMPSGYSSKAGQTHNPFDPLNLSPEGSSFGSGAAAAANFSAVAPVKSLSDLIAFNQKDPSRRAKYGQDLLEDANEVTEFDKAKVEAMVKTAQSRIDDLLRDEKLDALVFYDNEGVLVPATAGYPELTVPAGVSDEGAPRGATFVAGRNEDEKLLNIAYSFEQKTAARAIPENYLN GT:EXON 1|1-374:0| BL:SWS:NREP 2 BL:SWS:REP 74->217|GATA_LAWIP|1e-17|40.4|136/485| BL:SWS:REP 298->363|GATA_THIDA|4e-05|30.3|66/485| TM:NTM 1 TM:REGION 7->29| SEG 5->28|lkiilpasiilialvgvaiaalal| SEG 225->242|gssfgsgaaaaanfsava| BL:PDB:NREP 1 BL:PDB:REP 72->216,243->369|1m22A|2e-23|40.3|270/487| RP:PDB:NREP 1 RP:PDB:REP 72->218,246->363|2dqnA|2e-27|29.5|256/485| RP:PFM:NREP 1 RP:PFM:REP 92->218|PF01425|4e-17|47.9|119/425|Amidase| HM:PFM:NREP 2 HM:PFM:REP 91->242|PF01425|5.8e-33|36.4|143/435|Amidase| HM:PFM:REP 312->353|PF01425|5.4e-06|40.5|42/435|Amidase| GO:PFM:NREP 1 GO:PFM GO:0016884|"GO:carbon-nitrogen ligase activity, with glutamine as amido-N-donor"|PF01425|IPR000120| RP:SCP:NREP 1 RP:SCP:REP 72->218,243->369|1m21A|2e-33|42.5|272/487|c.117.1.1| HM:SCP:REP 67->242|1m22A_|1.7e-39|38.5|174/490|c.117.1.1|1/2|Amidase signature (AS) enzymes| HM:SCP:REP 320->372|2f2aA1|1.3e-09|38.5|52/0|c.117.1.1|2/2|Amidase signature (AS) enzymes| OP:NHOMO 619 OP:NHOMOORG 421 OP:PATTERN ---1---2---------------1------------------------11111-------------11 -2111---112-1-2--11-1---111111111-----1-----2---112131------111--141211----111--1---1--1---------------11---1--------1--11111-11-1-111--111-1--11-111-111-111--------111112-111---1-1--2221111-1--22222322-222222------222---1-1222221123--------------------2111--11111--111-1-1111-------------11111111111----------------------2-1-11------------------111--1--1-121-1--2--111-1-13-11111-------2-1--111---------------22-21-1--2--1111--2----11--1--11-1--112---------11-1--1------------------------------11---211-1-------1111--521111-1113123-------------1---1-1--1---------------1111--11-1-1--111-1--11------1211---------------------------11-1---11--11111-1-1111-1--1-----1-1----------------------------------------------------------------------------------------------111111111-2------------------11111-------2222112211111-11-1--------1--------------1111111111---------------------------------1--------1----11----1--------- ---------------3363-434343323233312222121223-2113945B5--221222-----22-----11-111------1--2223-------------------111--1-1-1--11-1-251-113-1111-1-111-111--1-----------1---------111--11-12253A514------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 73.8 SQ:SECSTR #####################################################################TTTccHHHHHHHHHTTcccHHHHHHHHHHHHHHHHGcTHHHccEEEEcHHHHHHHHHHHHHHHTTccccccEEEEETTcccTTccccTTcGGGTTcccccccHHHHHHHHTTcEEEEEEcccGGGccccTTccccTTccccccccTTcT########################ccccHHHHHHHHHHHHHHHHHHHHHHHHHcTTTHHHHHHHHHHHHHHHHHHHHHHHHTTcTTcHHHHHHTTTTTHHHHTccEEEEEEEEETETEEEEEEEEccTTcHHHHHHHHHHHHHHcEEEEcT##### PSIPRED cccEEEEEEEHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHccccccccccccHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccccccccccEEEEEEEEcccccccccccHHHcccccccccHHHHHHHHcccEEEEEEcHHHHHccccccccccccccccccccccccccEEEEccccHHHHHHHHHHcccccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccccHHHHHHHHccHHHHHcccccccEEEEcccccccHHHHHccccEEEccEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHccccccccccc //