[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54745.1
DDBJ      :             prevent-host-death family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.306.1
:61 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->51 3g5oA PDBj 2e-04 33.3 %
:RPS:PDB   6->54 2a6qB PDBj 2e-05 22.4 %
:RPS:SCOP  6->56 2a6qB1  d.306.1.1 * 2e-06 21.6 %
:HMM:SCOP  2->56 2a6qA1 d.306.1.1 * 5.5e-08 25.5 %
:HMM:PFM   4->60 PF02604 * PhdYeFM 1.4e-12 22.8 57/75  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54745.1 GT:GENE ACV54745.1 GT:PRODUCT prevent-host-death family protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 961707..961892 GB:FROM 961707 GB:TO 961892 GB:DIRECTION + GB:PRODUCT prevent-host-death family protein GB:NOTE TIGRFAM: prevent-host-death family protein GB:PROTEIN_ID ACV54745.1 GB:DB_XREF GI:257474425 InterPro:IPR006442 LENGTH 61 SQ:AASEQ MAIIRPVTELQRKVGELSRLAKETKEPIYLTKNGAEHLVLIDSDTFAALQKRAEEMHQNQK GT:EXON 1|1-61:0| BL:PDB:NREP 1 BL:PDB:REP 4->51|3g5oA|2e-04|33.3|48/92| RP:PDB:NREP 1 RP:PDB:REP 6->54|2a6qB|2e-05|22.4|49/58| HM:PFM:NREP 1 HM:PFM:REP 4->60|PF02604|1.4e-12|22.8|57/75|PhdYeFM| RP:SCP:NREP 1 RP:SCP:REP 6->56|2a6qB1|2e-06|21.6|51/55|d.306.1.1| HM:SCP:REP 2->56|2a6qA1|5.5e-08|25.5|55/0|d.306.1.1|1/1|YefM-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 86.9 SQ:SECSTR ###EEEHHHHHHHHHHHHHHHHHHTccEEEEccccccEEEccHHHHHHHHHHHTHH##### DISOP:02AL 54-54,59-62| PSIPRED ccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccEEEEEHHHHHHHHHHHHHHHHccc //