[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54750.1
DDBJ      :             4Fe-4S ferredoxin iron-sulfur binding domain protein
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  114/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   233->280 1hfeL PDBj 1e-06 37.5 %
:RPS:PDB   233->284 1bqxA PDBj 3e-07 30.8 %
:RPS:SCOP  209->282 1hfeL2  d.58.1.5 * 1e-08 27.1 %
:HMM:SCOP  84->283 1h7wA5 d.58.1.5 * 1.8e-16 27.8 %
:HMM:PFM   239->253 PF00037 * Fer4 0.00018 46.7 15/24  
:HMM:PFM   263->281 PF00037 * Fer4 5.8e-09 52.6 19/24  
:BLT:SWISS 211->282 Y749_METJA 2e-13 31.9 %
:BLT:SWISS 263->280 RNFB_PSEU5 5e-04 83.3 %
:PROS 265->276|PS00198|4FE4S_FER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54750.1 GT:GENE ACV54750.1 GT:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(971650..972552) GB:FROM 971650 GB:TO 972552 GB:DIRECTION - GB:PRODUCT 4Fe-4S ferredoxin iron-sulfur binding domain protein GB:NOTE PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG: pca:Pcar_1070 ferredoxin GB:PROTEIN_ID ACV54750.1 GB:DB_XREF GI:257474430 InterPro:IPR001450 InterPro:IPR017900 LENGTH 300 SQ:AASEQ MDKRENTASHILARFRGFIQAVATLITNIHLPNFAKGGIYQGAEKTVCVPGLNCYSCPAAAGACPIGAFQSVVGSSKFSFSYYVTGTLILLGVLLGRFVCGFLCPFGWLQELLHKIPCKKLSTKRLKPLTYIKYGVLLLAVVLLPVLVVNDVGMGDPFFCKYICPQGVLEGAIPLAAVNAGIRSALGQLFTWKLFVLIAVVVLSVLFYRPFCKWICPLGAFYALMNKVSLLGIRVDACKCVSCGTCSKVCQMDVDVVRAPNHAECIRCGKCIGACPVDAISYRYGLDVSEEKLPLTADKK GT:EXON 1|1-300:0| BL:SWS:NREP 2 BL:SWS:REP 211->282|Y749_METJA|2e-13|31.9|72/246| BL:SWS:REP 263->280|RNFB_PSEU5|5e-04|83.3|18/191| PROS 265->276|PS00198|4FE4S_FER_1|PDOC00176| TM:NTM 5 TM:REGION 54->76| TM:REGION 85->107| TM:REGION 132->154| TM:REGION 188->210| TM:REGION 218->240| SEG 57->68|cpaaagacpiga| SEG 84->96|vtgtlillgvllg| SEG 136->149|vlllavvllpvlvv| BL:PDB:NREP 1 BL:PDB:REP 233->280|1hfeL|1e-06|37.5|48/396| RP:PDB:NREP 1 RP:PDB:REP 233->284|1bqxA|3e-07|30.8|52/77| HM:PFM:NREP 2 HM:PFM:REP 239->253|PF00037|0.00018|46.7|15/24|Fer4| HM:PFM:REP 263->281|PF00037|5.8e-09|52.6|19/24|Fer4| RP:SCP:NREP 1 RP:SCP:REP 209->282|1hfeL2|1e-08|27.1|70/85|d.58.1.5| HM:SCP:REP 84->283|1h7wA5|1.8e-16|27.8|133/173|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 153 OP:NHOMOORG 130 OP:PATTERN ---1-1----------1------------------122-111--1112-211---------------- --2---------------------------------------------------------------------------1-65---1-1111--1--------------1------------------------1------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------113----------12------21-11--11211-1-2------------------------------------------------1---1-----------------------------------------------1------------------------------------------------------------------------------------------1----------------1-11--111-11111---11-111------1-11312-1111-1-1--------111---11--------------------------------1--------1------1111111111-111111111111-11111----11--------------------11-111---------------------------------111---------1-------------1------------------------------1----------------------------11------------1----------------------------1---------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 43.0 SQ:SECSTR ##################################################################################################################################################################ccccccccTTcccTTccc##ccccccccccccccHHHHHHHHHHHHccTHHHHcccccEEEETTEEHHHHEcccTTcccccccccTTcTTccEEEccccTTTcccccHHHHHcTTcccEETTTccccHHHH####### DISOP:02AL 8-20,300-301| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccEEEEcccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccEEEEEEEHHHcccHHHHHHHcccccEEcccccHHHcccccHHHHHcccccEEccccccccccccccccccc //