[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54754.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:201 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   48->174 3e27B PDBj 6e-04 14.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54754.1 GT:GENE ACV54754.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(975614..976219) GB:FROM 975614 GB:TO 976219 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: dol:Dole_3138 hypothetical protein GB:PROTEIN_ID ACV54754.1 GB:DB_XREF GI:257474434 LENGTH 201 SQ:AASEQ MDRSEEIAEFVEDSGGIASAAQIAKAGFLPGSISYALESGAIDKLTRGVYCLPEVFDDEFAAISYRWSKCVLSHGSALYLAGLSDKVPAAIDVTVPRGYNPRGLTQEYPDTKIHRLSPELYELGIVKAKSPGGGTVKAYCAERAVADLISQRVSEGADPQLVRDAVAGYFKRKGADLPKLARMCNALGVEKEFRMYLEVLT GT:EXON 1|1-201:0| RP:PDB:NREP 1 RP:PDB:REP 48->174|3e27B|6e-04|14.3|119/188| OP:NHOMO 32 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------11-------------------------------------------------1-11---------------------------------------------------------------------------------------------------------------------------------------2---------1-1--11------1-1-1--1--------------1111-1-1---------------------------22--2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------1-------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 59.2 SQ:SECSTR ###############################################TTcTTEEEccTTTTccccccHHHHHHHHHHHcTTcEEEEEEHHHHHHGGGcTTHHHHTTTcEEEEEccTTccccccccc########EEEccccccccHHHHHHHHHTTccTTTccHHHHHHHHHTT########################### DISOP:02AL 201-202| PSIPRED ccHHHHHHHHHHHHcccEEHHHHHHccccHHHHHHHHHcccEEEEcccEEEccccccHHHHHHHHHHcccEEEHHHHHHHcccccccccEEEEEEEccccccccccccccEEEEEEcHHHcccccEEEEEEccEEEEEccHHHHHHHHHHccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHc //