[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54763.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->64 PF04133 * Vps55 0.00014 25.0 52/120  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54763.1 GT:GENE ACV54763.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 983597..983812 GB:FROM 983597 GB:TO 983812 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54763.1 GB:DB_XREF GI:257474443 LENGTH 71 SQ:AASEQ MLSQIISLVSGCVTFLGGFLVVWGAVSLGLAIREQQGGSQIASAISTIAGGAIIIAAAVYFGMLDTSWLPA GT:EXON 1|1-71:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 40->62| SEG 37->58|ggsqiasaistiaggaiiiaaa| HM:PFM:NREP 1 HM:PFM:REP 11->64|PF04133|0.00014|25.0|52/120|Vps55| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------21----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccc //