[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54772.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:70 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   29->69 1bdvC PDBj 2e-04 26.8 %
:RPS:SCOP  28->67 1bazA  a.43.1.1 * 3e-04 25.0 %
:HMM:SCOP  24->69 1mntA_ a.43.1.1 * 7.1e-05 37.0 %
:HMM:PFM   30->58 PF01402 * RHH_1 6.4e-05 37.9 29/39  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54772.1 GT:GENE ACV54772.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 995414..995626 GB:FROM 995414 GB:TO 995626 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54772.1 GB:DB_XREF GI:257474452 LENGTH 70 SQ:AASEQ MPTTYKQLIDANPSQTEIRSYLVDGDQVSVTLRIPDTLRDAAKEEAALRGMSFSAFVRTCMIEELAKKGA GT:EXON 1|1-70:0| RP:PDB:NREP 1 RP:PDB:REP 29->69|1bdvC|2e-04|26.8|41/43| HM:PFM:NREP 1 HM:PFM:REP 30->58|PF01402|6.4e-05|37.9|29/39|RHH_1| RP:SCP:NREP 1 RP:SCP:REP 28->67|1bazA|3e-04|25.0|40/49|a.43.1.1| HM:SCP:REP 24->69|1mntA_|7.1e-05|37.0|46/0|a.43.1.1|1/1|Ribbon-helix-helix| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------112----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 64.3 SQ:SECSTR ########################TTcccccccccHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHTTc# DISOP:02AL 17-18,20-20,25-25,39-39,45-46,48-48,53-54,59-60,62-62| PSIPRED ccHHHHHHHcccccHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc //