Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54781.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54781.1 GT:GENE ACV54781.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1006579..1006779 GB:FROM 1006579 GB:TO 1006779 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54781.1 GB:DB_XREF GI:257474461 LENGTH 66 SQ:AASEQ MSRRAPQEGRSYEQALYSVVLLVPRLPRPERTRTVRVLLDFIAGLWELDRSRVDADFASLVRGLPR GT:EXON 1|1-66:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-25| PSIPRED cccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //