[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54794.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   91->163 PF11611 * TRF2 0.0002 13.7 73/123  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54794.1 GT:GENE ACV54794.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1021896..1022453 GB:FROM 1021896 GB:TO 1022453 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: SBAB-279G2.4; ring finger protein 1 ; K10695 E3 ubiquitin-protein ligase RNF1/2 GB:PROTEIN_ID ACV54794.1 GB:DB_XREF GI:257474474 LENGTH 185 SQ:AASEQ MTGKNVYTMTAMTRRAFVGLAVMAAQAGLAGCVRNGAPDAGSSDGGAGKSGDAGTSSPFAPQQSAQASVDGISIDRVTIEEGTGPDGKPFRYIRVAYTFENVTDSDAVAPYTDINAYQDGIKLDRSYKVQDQRAQKQIEPGGKLKSFTAFAPDSETVPVTVKVMAPGEKEPRSERCYCIVNPGLQ GT:EXON 1|1-185:0| SEG 36->57|gapdagssdggagksgdagtss| HM:PFM:NREP 1 HM:PFM:REP 91->163|PF11611|0.0002|13.7|73/123|TRF2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,45-45,48-48,53-53,67-67,73-74,76-76,81-82,87-87,137-137,143-144,146-146,151-151,185-186| PSIPRED cccccEEEEEHHHHHHHHHHHHHHHHcHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccEEEEEEEEEEcccccccccccccccHHHHccEEccccEEEcHHHHHHHccccccEEEEEEccccccEEEEEEEEEcccccccccccEEEEEccccc //