[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54804.1
DDBJ      :             single-strand binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  835/915 : Eukaryota  8/199 : Viruses  18/175   --->[See Alignment]
b.40.4
:141 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->103 1x3eB PDBj 1e-17 41.8 %
:RPS:PDB   2->109 3eivC PDBj 3e-26 30.7 %
:RPS:SCOP  2->111 1eqqA  b.40.4.3 * 1e-29 33.6 %
:HMM:SCOP  1->141 1se8A_ b.40.4.3 * 1.1e-44 42.9 %
:RPS:PFM   3->106 PF00436 * SSB 1e-20 46.6 %
:HMM:PFM   3->106 PF00436 * SSB 1.7e-35 42.7 103/104  
:BLT:SWISS 2->106 SSB_RHOBA 5e-24 46.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54804.1 GT:GENE ACV54804.1 GT:PRODUCT single-strand binding protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION 1027976..1028401 GB:FROM 1027976 GB:TO 1028401 GB:DIRECTION + GB:PRODUCT single-strand binding protein GB:NOTE TIGRFAM: single-strand binding protein; PFAM: single-strand binding protein/Primosomal replication protein n; nucleic acid binding OB-fold tRNA/helicase-type; KEGG: nis:NIS_1165 single-strand DNA binding protein GB:PROTEIN_ID ACV54804.1 GB:DB_XREF GI:257474484 InterPro:IPR000424 InterPro:IPR004365 InterPro:IPR011344 LENGTH 141 SQ:AASEQ MSINRVNITGNLTRDPELRATAAGTQVLSFGIAVNDRRKNPQTGEWEDYPNYIDCTMFGTRAEAVGRYISKGSKVAIEGKLRYSSWERDGQKRSKLEVIVDEIEFMNSRPAASPAAAVDGGQQYAVPEAPAVEVADEDIPF GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 2->106|SSB_RHOBA|5e-24|46.2|104/169| SEG 125->138|avpeapavevaded| BL:PDB:NREP 1 BL:PDB:REP 6->103|1x3eB|1e-17|41.8|98/119| RP:PDB:NREP 1 RP:PDB:REP 2->109|3eivC|3e-26|30.7|101/111| RP:PFM:NREP 1 RP:PFM:REP 3->106|PF00436|1e-20|46.6|103/104|SSB| HM:PFM:NREP 1 HM:PFM:REP 3->106|PF00436|1.7e-35|42.7|103/104|SSB| GO:PFM:NREP 1 GO:PFM GO:0003697|"GO:single-stranded DNA binding"|PF00436|IPR000424| RP:SCP:NREP 1 RP:SCP:REP 2->111|1eqqA|1e-29|33.6|110/114|b.40.4.3| HM:SCP:REP 1->141|1se8A_|1.1e-44|42.9|140/0|b.40.4.3|1/1|Nucleic acid-binding proteins| OP:NHOMO 1199 OP:NHOMOORG 861 OP:PATTERN -------------------------------------------------------------------- 111232211131211-111-11111111111111111211111211113111223111111111112111111112212223111111121112111----11311112---------------1222222222223332211121111-11-111111111-1112111111111111111112-1111-2122222222222212221122122122132111422332115322222212443223112151112212111211133111111321422323222-22222323232143323332223322222222221113212122435321122112121214112112113111111---1111211-1111111211111--2-----11111111111-111111111--11---11-111---211111-12111311111111111111211--------1-1111111111111111-11-1-31111112211112111112211111111131122211431121311211121211111121111111111111121111111211111111212113111112111121111212111111111111111331111211111111111111211111111111-2111111111111111111221121221-2112242111221221221311111222111211121222213311111112111111111111111311111122221111111112123112222111111211111111111111111211121111111111111111111111111111111111-432411112212221116111111121221---1--------1----111111-111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1---------11-----1-1-----1-----1---- -----------------------------1-----------1---1--------------1-----------------1---11----------1----------1-111------------1----11-----11-----------------1--------------------- STR:NPRED 112 STR:RPRED 79.4 SQ:SECSTR ccccEEEEEEEEccccEEEEcTTccEEEEEEEEEccEEEETTTTEEEcccEEEEEEEETHHHHHHHHHccTTcEEEEEEEEEEEcccEEEEEEEEEEEEEEEEEEccTTHHc############################# PSIPRED cccEEEEEEEEEccccEEEEcccccEEEEEEEEEcccccccccccEEcccEEEEEEEEccHHHHHHHHcccccEEEEEEEEEEccccccccEEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccc //