[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54821.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   67->110 1tqyB PDBj 1e-04 45.5 %
:HMM:PFM   17->53 PF00392 * GntR 4.9e-05 40.5 37/64  
:BLT:SWISS 67->110 KASB_STRCO 3e-04 45.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54821.1 GT:GENE ACV54821.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1042238..1042777) GB:FROM 1042238 GB:TO 1042777 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: pmr:PMI2492 hypothetical protein GB:PROTEIN_ID ACV54821.1 GB:DB_XREF GI:257474501 LENGTH 179 SQ:AASEQ MKSVEAIKILHGCDLEGRILFRSRELGALFDEHGDTLRSTIKRLTADGILERVAHDAYLYLLSHPNGCDLLGHIAAFLRPGGATYESLESAASQWGFISQIPLGRISCVTTGAEGLVDTRFGAIEFVHTDDDLDAVKRGIIDRMPRNRLPIATEERCLHDLVSRKRSLELIDWDEVDVD GT:EXON 1|1-179:0| BL:SWS:NREP 1 BL:SWS:REP 67->110|KASB_STRCO|3e-04|45.5|44/100| BL:PDB:NREP 1 BL:PDB:REP 67->110|1tqyB|1e-04|45.5|44/402| HM:PFM:NREP 1 HM:PFM:REP 17->53|PF00392|4.9e-05|40.5|37/64|GntR| OP:NHOMO 15 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------11--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------1----------------1-----------------------------1---------------------------------------22-------------------------------------------------------1--------------------------1-------------------------------------2---------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 44 STR:RPRED 24.6 SQ:SECSTR ##################################################################HHHHHHHHHHHHHHTccEEEEEEccccHHHHHHHHTTccccccc##################################################################### PSIPRED ccHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccccHHHHHHHHHcccccHHHHHHHHHHcccEEEccccEEEEEEEccccccccccEEEEEEEccccHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHccHHHcccc //