[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54826.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:329 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   134->199 1bibA PDBj 5e-04 16.7 %
:HMM:PFM   183->251 PF08214 * KAT11 0.00092 21.0 62/343  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54826.1 GT:GENE ACV54826.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1046878..1047867) GB:FROM 1046878 GB:TO 1047867 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: dol:Dole_0232 hypothetical protein GB:PROTEIN_ID ACV54826.1 GB:DB_XREF GI:257474506 LENGTH 329 SQ:AASEQ MREYVEKTLHTRVDCEPVDASGLPLYLRGLYSLERWTAFGVPFAVASPVESPTAKTMAKHRDALEAALGTPVAFALEGATAYRVGRMLEAGLPFIEPSGQVYLPFLGIALSSRRSHARDRRQTDVGTFSPQAQRLALMALYGDLDGASVTQAAGLLGAAKMTASRAFDELAAADPSIVAAEGRRRVLRPGRDKMAMWRHLEPRMSSPVAREHRLGRVPDAELPLGGLSALCGLSMLQDDPWPTFAATKAQERTLGLAADARDTGLDEPEDPACVVQVLRYEPVPAPGCAVDPLSAILSLPADERDDPRVAGEIENVLNRVLGGDHEGNR GT:EXON 1|1-329:0| RP:PDB:NREP 1 RP:PDB:REP 134->199|1bibA|5e-04|16.7|66/294| HM:PFM:NREP 1 HM:PFM:REP 183->251|PF08214|0.00092|21.0|62/343|KAT11| OP:NHOMO 10 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1-----------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1--------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 20.1 SQ:SECSTR #####################################################################################################################################HHHHHHHHTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHH################################################################################################################################## DISOP:02AL 101-101,104-104,109-109,129-129,137-137,277-277,283-283,311-311,314-314,329-330| PSIPRED cHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccHHcccccccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccccccccccEEEEEEEEHHccHHHHHHHHHHccccccccHHHHHEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccccHHHHHHHHccHHccccHHHHHHccccccccccccHHHHHHHHHHHHccccccHHccHHHHHHHccccccccccccccccHHHEEHEEEccccccccccccHHHHHHcccccccccccHHHHHHHHHHHHHcccccccc //