[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54851.1
DDBJ      :             transcriptional regulator, XRE family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:97 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->60 3f52E PDBj 3e-05 30.0 %
:RPS:PDB   1->61 3dnvB PDBj 3e-12 21.3 %
:RPS:SCOP  6->61 2auwA1  a.35.1.10 * 1e-11 17.9 %
:HMM:SCOP  1->80 1rioA_ a.35.1.2 * 5.9e-11 28.8 %
:RPS:PFM   11->59 PF01381 * HTH_3 8e-06 40.8 %
:HMM:PFM   11->58 PF01381 * HTH_3 1.9e-16 41.7 48/55  
:HMM:PFM   46->94 PF10507 * DUF2453 0.00084 22.4 49/111  
:BLT:SWISS 1->55 MBF1_ASHGO 4e-05 34.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54851.1 GT:GENE ACV54851.1 GT:PRODUCT transcriptional regulator, XRE family GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1076976..1077269) GB:FROM 1076976 GB:TO 1077269 GB:DIRECTION - GB:PRODUCT transcriptional regulator, XRE family GB:NOTE PFAM: helix-turn-helix domain protein; SMART: helix-turn-helix domain protein; KEGG: afw:Anae109_1193 helix-turn-helix domain- containing protein GB:PROTEIN_ID ACV54851.1 GB:DB_XREF GI:257474531 InterPro:IPR001387 LENGTH 97 SQ:AASEQ MGNASRPASAERGMSQKELAEAAGLTPASVSRYVNGERLPWPATIAAMSRALGVEPSDIIGTSCDQELDDAVHHVARNADSLTEAQRAELIAALAKR GT:EXON 1|1-97:0| BL:SWS:NREP 1 BL:SWS:REP 1->55|MBF1_ASHGO|4e-05|34.5|55/152| BL:PDB:NREP 1 BL:PDB:REP 1->60|3f52E|3e-05|30.0|60/78| RP:PDB:NREP 1 RP:PDB:REP 1->61|3dnvB|3e-12|21.3|61/71| RP:PFM:NREP 1 RP:PFM:REP 11->59|PF01381|8e-06|40.8|49/55|HTH_3| HM:PFM:NREP 2 HM:PFM:REP 11->58|PF01381|1.9e-16|41.7|48/55|HTH_3| HM:PFM:REP 46->94|PF10507|0.00084|22.4|49/111|DUF2453| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 6->61|2auwA1|1e-11|17.9|56/67|a.35.1.10| HM:SCP:REP 1->80|1rioA_|5.9e-11|28.8|80/0|a.35.1.2|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHHcGGGccHHHHHHHHHHTTccccccccHHHHHHTHHHHHHHHHHHHccccHHHHHHHHHHHHH DISOP:02AL 8-15,17-18,73-73,76-76,81-81,87-87,90-90| PSIPRED ccccccccHHHHcccHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHccccHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcc //