[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54852.1
DDBJ      :             protein of unknown function DUF192
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:HMM:PFM   27->111 PF02643 * DUF192 2.8e-13 32.1 78/108  
:BLT:SWISS 27->108 Y1377_METTH 2e-07 40.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54852.1 GT:GENE ACV54852.1 GT:PRODUCT protein of unknown function DUF192 GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1077402..1077782) GB:FROM 1077402 GB:TO 1077782 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF192 GB:NOTE PFAM: protein of unknown function DUF192; KEGG: afr:AFE_2872 hypothetical protein GB:PROTEIN_ID ACV54852.1 GB:DB_XREF GI:257474532 InterPro:IPR003795 LENGTH 126 SQ:AASEQ MNDRYLDEAVAVTASGKRVPILTHTCRGFLERFCGLMLKREVPEACGLYFPGCRSIHTCMMRVPIDVVWVREGEPGELDAVSLDVALKPWRFFAAPRGATGCVEFRAGSFDPADRPAEIARPKKRK GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 27->108|Y1377_METTH|2e-07|40.3|77/123| HM:PFM:NREP 1 HM:PFM:REP 27->111|PF02643|2.8e-13|32.1|78/108|DUF192| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccccccccEEEEcccccEEEEEHHHcccHHHHHHHHccccccccccEEEEccccEEEccccccEEEEEEEEccccEEEEEEEEccccccccEEcccccccEEEEEEccccccccccHHHccccccc //