[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54861.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->68 PF04964 * Flp_Fap 9.5e-05 29.7 37/47  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54861.1 GT:GENE ACV54861.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1084742..1084993) GB:FROM 1084742 GB:TO 1084993 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54861.1 GB:DB_XREF GI:257474541 LENGTH 83 SQ:AASEQ MNDILAKPAAIATCGLFNMKRRAKEALSAQGSIEWVVIVVCIAVALIAALIYLSNQMNVKINTVSDTLSKTGISGAVPGQGGH GT:EXON 1|1-83:0| TM:NTM 1 TM:REGION 32->54| SEG 36->51|vvivvciavaliaali| HM:PFM:NREP 1 HM:PFM:REP 32->68|PF04964|9.5e-05|29.7|37/47|Flp_Fap| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-45,53-53,67-67,73-74,76-76| PSIPRED ccHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHcccccccccccc //