[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Eggerthella lenta DSM 2243 (elen0)
Gene : ACV54865.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACV54865.1 GT:GENE ACV54865.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB01015CH01 GT:ORG elen0 GB:ACCESSION GIB01015CH01 GB:LOCATION complement(1091467..1091862) GB:FROM 1091467 GB:TO 1091862 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ACV54865.1 GB:DB_XREF GI:257474545 LENGTH 131 SQ:AASEQ MNPIDLVKHSNIEPHELRRIALAAILTALPPAIFQLQSAASVILSCPTDYYSPASAAWFLTRGCLGAVWVPVILLIVAGIACKVRSRALDLGIAAVLFALTVRSAIRLDPYSIGYLATAFTCFAVSGLKEE GT:EXON 1|1-131:0| TM:NTM 4 TM:REGION 23->45| TM:REGION 60->82| TM:REGION 87->106| TM:REGION 112->128| SEG 17->33|lrrialaailtalppai| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,45-46,48-48,53-53,67-67,115-115,118-118| PSIPRED ccHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccc //